ABLIM1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ABLIM1
Ідентифікатори
Символи ABLIM1, ABLIM, LIMAB1, LIMATIN, abLIM-1, actin binding LIM protein 1
Зовнішні ІД OMIM: 602330 MGI: 1194500 HomoloGene: 40994 GeneCards: ABLIM1
Пов'язані генетичні захворювання
Ожиріння, рак простати[1]
Шаблон експресії
PBB GE ABLIM1 210461 s at fs.png

PBB GE ABLIM1 200965 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 10: 114.43 – 114.77 Mb Хр. 19: 57.03 – 57.31 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ABLIM1 (англ. Actin binding LIM protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 778 амінокислот, а молекулярна маса — 87 688[5].

Послідовність амінокислот
1020304050
MPAFLGLKCLGKLCSSEKSKVTSSERTSARGSNRKRLIVEDRRVSGTSFT
AHRRATITHLLYLCPKDYCPRGRVCNSVDPFVAHPQDPHHPSEKPVIHCH
KCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDY
QRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFN
GRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGC
FKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAG
DKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTR
TSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIER
PDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRS
TSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSRP
LTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKF
PAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRR
QLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPS
SKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMR
MDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFR
EIFGMSIQEFDRLPLWRRNDMKKKAKLF

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном цинку. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Roof D.J., Hayes A., Adamian M., Chishti A.H., Li T. (1997). Molecular characterization of abLIM, a novel actin-binding and double zinc finger protein.. J. Cell Biol. 138: 575 — 588.  PubMed DOI:10.1083/jcb.138.3.575
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]