ALDH5A1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ALDH5A1
Protein ALDH5A1 PDB 2W8N.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ALDH5A1, SSADH, SSDH, Aldehyde dehydrogenase 5 family, member A1, aldehyde dehydrogenase 5 family member A1
Зовнішні ІД OMIM: 610045 MGI: 2441982 HomoloGene: 840 GeneCards: ALDH5A1
Пов'язані генетичні захворювання
succinic semialdehyde dehydrogenase deficiency[1]
Шаблон експресії
PBB GE ALDH5A1 203608 at fs.png

PBB GE ALDH5A1 203609 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_170740
NM_001080
NM_001368954
NM_172532
RefSeq (білок)
NP_001071
NP_733936
NP_001355883
NP_766120
Локус (UCSC) Хр. 6: 24.49 – 24.54 Mb Хр. 13: 24.91 – 24.94 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ALDH5A1 (англ. Aldehyde dehydrogenase 5 family member A1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 535 амінокислот, а молекулярна маса — 57 215[5].

Послідовність амінокислот
1020304050
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGR
LAGLSAALLRTDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARA
AVRAAYEAFCRWREVSAKERSSLLRKWYNLMIQNKDDLARIITAESGKPL
KEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAV
ITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIP
SGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV
KRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQR
GIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAV
SKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFD
TEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSV
ECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з НАД. Локалізований у мітохондрії.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]