BFSP1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BFSP1
Ідентифікатори
Символи BFSP1, CP115, CP94, CTRCT33, LIFL-H, beaded filament structural protein 1
Зовнішні ІД OMIM: 603307 MGI: 101770 HomoloGene: 922 GeneCards: BFSP1
Пов'язані генетичні захворювання
cataract 33[1]
Шаблон експресії
PBB GE BFSP1 206746 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001161705
NM_001195
NM_001278606
NM_001278607
NM_001278608
NM_001291061
NM_009751
RefSeq (білок)
NP_001155177
NP_001186
NP_001265535
NP_001265536
NP_001265537
NP_001277990
NP_033881
Локус (UCSC) Хр. 20: 17.49 – 17.57 Mb Хр. 2: 143.67 – 143.71 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BFSP1 (англ. Beaded filament structural protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 665 амінокислот, а молекулярна маса — 74 544[5].

Послідовність амінокислот
1020304050
MYRRSYVFQTRKEQYEHADEASRAAEPERPADEGWAGATSLAALQGLGER
VAAHVQRARALEQRHAGLRRQLDAFQRLGELAGPEDALARQVESNRQRVR
DLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEMLERLNKEADE
ALLHNLRLQLEAQFLQDDISAAKDRHKKNLLEVQTYISILQQIIHTTPPA
SIVTSGMREEKLLTEREVAALRSQLEEGREVLSHLQAQRVELQAQTTTLE
QAIKSAHECYDDEIQLYNEQIETLRKEIEETERVLEKSSYDCRQLAVAQQ
TLKNELDRYHRIIEIEGNRLTSAFIETPIPLFTQSHGVSLSTGSGGKDLT
RALQDITAAKPRQKALPKNVPRRKEIITKDKTNGALEDAPLKGLEDTKLV
QVVLKEESESKFESESKEVSPLTQEGAPEDVPDGGQISKGFGKLYRKVKE
KVRSPKEPETPTELYTKERHVLVTGDANYVDPRFYVSSITAKGGVAVSVA
EDSVLYDGQVEPSPESPKPPLENGQVGLQEKEDGQPIDQQPIDKEIEPDG
AELEGPEEKREGEERDEESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEV
LGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMI
GKTKSDKKKSGEKSS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, проміжних філаментах.

Література[ред. | ред. код]

  • Hess J.F., Casselman J.T., Kong A.P., FitzGerald P.G. (1998). Primary sequence, secondary structure, gene structure, and assembly properties suggests that the lens-specific cytoskeletal protein filensin represents a novel class of intermediate filament protein.. Exp. Eye Res. 66: 625 — 644.  PubMed DOI:10.1006/exer.1998.0478
  • Rendtorff N.D., Hansen C., Silahtaroglu A., Henriksen K.F., Tommerup N. (1998). Isolation of the human beaded-filament structural protein 1 gene (BFSP1) and assignment to chromosome 20p11.23-p12.1.. Genomics 53: 114 — 116.  PubMed DOI:10.1006/geno.1998.5478
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hess J.F., Casselman J.T., FitzGerald P.G. (1995). Chromosomal locations of the genes for the beaded filament proteins CP 115 and CP 47.. Curr. Eye Res. 14: 11 — 18.  PubMed DOI:10.3109/02713689508999909
  • Ramachandran R.D., Perumalsamy V., Hejtmancik J.F. (2007). Autosomal recessive juvenile onset cataract associated with mutation in BFSP1.. Hum. Genet. 121: 475 — 482.  PubMed DOI:10.1007/s00439-006-0319-6
  • Wang H., Zhang T., Wu D., Zhang J. (2013). A novel beaded filament structural protein 1 (BFSP1) gene mutation associated with autosomal dominant congenital cataract in a Chinese family.. Mol. Vis. 19: 2590 — 2595.  PubMed

Примітки[ред. | ред. код]

  1. Захворювання, генетично пов'язані з BFSP1 переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:1040 (англ.). Архів оригіналу за 7 квітня 2016. Процитовано 12 вересня 2017. 
  5. UniProt, Q12934 (англ.). Архів оригіналу за 28 квітня 2017. Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]