CDH12

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CDH12
Ідентифікатори
Символи CDH12, CDHB, cadherin 12
Зовнішні ІД MGI: 109503 HomoloGene: 37873 GeneCards: CDH12
Шаблон експресії
PBB GE CDH12 207149 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004061
NM_001317227
NM_001317228
NM_001008420
RefSeq (білок)
NP_001008420
Локус (UCSC) Хр. 5: 21.75 – 22.85 Mb Хр. 15: 20.45 – 21.59 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CDH12 (англ. Cadherin 12) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 794 амінокислот, а молекулярна маса — 88 332[4].

Послідовність амінокислот
1020304050
MLTRNCLSLLLWVLFDGGLLTPLQPQPQQTLATEPRENVIHLPGQRSHFQ
RVKRGWVWNQFFVLEEYVGSEPQYVGKLHSDLDKGEGTVKYTLSGDGAGT
VFTIDETTGDIHAIRSLDREEKPFYTLRAQAVDIETRKPLEPESEFIIKV
QDINDNEPKFLDGPYVATVPEMSPVGAYVLQVKATDADDPTYGNSARVVY
SILQGQPYFSIDPKTGVIRTALPNMDREVKEQYQVLIQAKDMGGQLGGLA
GTTIVNITLTDVNDNPPRFPKSIFHLKVPESSPIGSAIGRIRAVDPDFGQ
NAEIEYNIVPGDGGNLFDIVTDEDTQEGVIKLKKPLDFETKKAYTFKVEA
SNLHLDHRFHSAGPFKDTATVKISVLDVDEPPVFSKPLYTMEVYEDTPVG
TIIGAVTAQDLDVGSSAVRYFIDWKSDGDSYFTIDGNEGTIATNELLDRE
STAQYNFSIIASKVSNPLLTSKVNILINVLDVNEFPPEISVPYETAVCEN
AKPGQIIQIVSAADRDLSPAGQQFSFRLSPEAAIKPNFTVRDFRNNTAGI
ETRRNGYSRRQQELYFLPVVIEDSSYPVQSSTNTMTIRVCRCDSDGTILS
CNVEAIFLPVGLSTGALIAILLCIVILLAIVVLYVALRRQKKKDTLMTSK
EDIRDNVIHYDDEGGGEEDTQAFDIGALRNPKVIEENKIRRDIKPDSLCL
PRQRPPMEDNTDIRDFIHQRLQENDVDPTAPPYDSLATYAYEGSGSVAES
LSSIDSLTTEADQDYDYLTDWGPRFKVLADMFGEEESYNPDKVT

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як клітинна адгезія, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tanihara H., Sano K., Heimark R.L., St John T., Suzuki S. (1994). Cloning of five human cadherins clarifies characteristic features of cadherin extracellular domain and provides further evidence for two structurally different types of cadherin.. Cell Adhes. Commun. 2: 15 — 26.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1751 (англ.). Процитовано 31 серпня 2017. 
  4. UniProt, P55289 (англ.). Процитовано 31 серпня 2017. 

Див. також[ред. | ред. код]