CREG1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CREG1
Protein CREG1 PDB 1xhn.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CREG1, CREG, cellular repressor of E1A stimulated genes 1
Зовнішні ІД OMIM: 618055 MGI: 1344382 HomoloGene: 31199 GeneCards: CREG1
Шаблон експресії
PBB GE CREG1 201200 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003851
NM_011804
RefSeq (білок)
NP_003842
NP_035934
Локус (UCSC) Хр. 1: 167.53 – 167.55 Mb Хр. 1: 165.76 – 165.78 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CREG1 (англ. Cellular repressor of E1A stimulated genes 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 220 амінокислот, а молекулярна маса — 24 075[4].

Послідовність амінокислот
1020304050
MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLP
PREDAARVARFVTHVSDWGALATISTLEAVRGRPFADVLSLSDGPPGAGS
GVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGFDPQSPLCVHI
MLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVL
DYFGGPKIVTPEEYYNVTVQ

Задіяний у такому біологічному процесі як регуляція росту. Секретований назовні.

Література[ред. | ред. код]

  • Veal E., Eisenstein M., Tseng Z.H., Gill G. (1998). A cellular repressor of E1A-stimulated genes that inhibits activation by E2F.. Mol. Cell. Biol. 18: 5032 — 5041.  PubMed DOI:10.1128/MCB.18.9.5032
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504
  • Veal E., Groisman R., Eisenstein M., Gill G. (2000). The secreted glycoprotein CREG enhances differentiation of NTERA-2 human embryonal carcinoma cells.. Oncogene 19: 2120 — 2128.  PubMed DOI:10.1038/sj.onc.1203529
  • Di Bacco A., Gill G. (2003). The secreted glycoprotein CREG inhibits cell growth dependent on the mannose-6-phosphate/insulin-like growth factor II receptor.. Oncogene 22: 5436 — 5445.  PubMed DOI:10.1038/sj.onc.1206670

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2351 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, O75629 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]