CRTAC1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CRTAC1
Ідентифікатори
Символи CRTAC1, ASPIC, ASPIC1, CEP-68, cartilage acidic protein 1, CEP68, LOTUS
Зовнішні ІД MGI: 1920082 HomoloGene: 23070 GeneCards: CRTAC1
Пов'язані генетичні захворювання
disease of metabolism[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001206528
NM_018058
NM_145123
NM_001356588
NM_001356589
RefSeq (білок)
NP_001193457
NP_060528
NP_660105
NP_001343517
NP_001343518
Локус (UCSC) Хр. 10: 97.87 – 98.03 Mb Хр. 19: 42.28 – 42.43 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CRTAC1 (англ. Cartilage acidic protein 1) – білок, який кодується однойменним геном, розташованим у людей на 10-ї хромосомі.[4] Довжина поліпептидного ланцюга білка становить 661 амінокислот, а молекулярна маса — 71 421[5].

Послідовність амінокислот
1020304050
MAPSADPGMSRMLPFLLLLWFLPITEGSQRAEPMFTAVTNSVLPPDYDSN
PTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLKYDRAQKRLVNIAVDER
SSPYYALRDRQGNAIGVTACDIDGDGREEIYFLNTNNAFSGVATYTDKLF
KFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRKGSGRYSIYIANYAY
GNVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILS
SSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADF
NRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVIT
ADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEP
EGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVP
RTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEA
SSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFS
QQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNE
DGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLG
SVVKESCEPSC

Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]