EPB41L5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
EPB41L5
Ідентифікатори
Символи EPB41L5, BE37, YMO1, YRT, erythrocyte membrane protein band 4.1 like 5
Зовнішні ІД MGI: 103006 HomoloGene: 32492 GeneCards: EPB41L5
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001113416
NM_145506
RefSeq (білок)
NP_001106887
NP_663481
Локус (UCSC) Хр. 2: 120.01 – 120.18 Mb Хр. 1: 119.55 – 119.65 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EPB41L5 (англ. Erythrocyte membrane protein band 4.1 like 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 733 амінокислот, а молекулярна маса — 81 856[4].

Послідовність амінокислот
1020304050
MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLL
DGTDVSVDLPKKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDG
TKSIKKQVKIGSPYCLHLRVKFYSSEPNNLREELTRYLFVLQLKQDILSG
KLDCPFDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVPIQTEEMELA
IFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLT
PTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGK
TEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVST
QSNGSQQAWGMRSALPVSPSISSAPVPVEIENLPQSPGTDQHDRKCIPLN
IDLLNSPDLLEATIGDVIGASDTMETSQALNDVNVATRLPGLGEPEVEYE
TLKDTSEKLKQLEMENSPLLSPRSNIDVNINSQEEVVKLTEKCLNNVIES
PGLNVMRVPPDFKSNILKAQVEAVHKVTKEDSLLSHKNANVQDAATNSAV
LNENNVPLPKESLETLMLITPADSGSVLKEATDELDALLASLTENLIDHT
VAPQVSSTSMITPRWIVPQSGAMSNGLAGCEMLLTGKEGHGNKDGISLIS
PPAPFLVDAVTSSGPILAEEAVLKQKCLLTTEL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Локалізований у цитоплазмі, клітинних контактах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 273 — 281.  PubMed DOI:10.1093/dnares/7.4.271

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:19819 (англ.). Процитовано 29 серпня 2017. 
  4. UniProt, Q9HCM4 (англ.). Процитовано 29 серпня 2017. 

Див. також[ред. | ред. код]