FCRL1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FCRL1
Ідентифікатори
Символи FCRL1, CD307a, FCRH1, IFGP1, IRTA5, Fc receptor like 1
Зовнішні ІД MGI: 2442862 HomoloGene: 50472 GeneCards: FCRL1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001159397
NM_001159398
NM_052938
NM_001136236
NM_153090
NM_178165
NM_001310545
RefSeq (білок)
NP_001152869
NP_001152870
NP_443170
NP_001129708
NP_001297474
NP_694730
NP_835459
Локус (UCSC) Хр. 1: 157.79 – 157.82 Mb Хр. 3: 87.38 – 87.4 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FCRL1 (англ. Fc receptor like 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 429 амінокислот, а молекулярна маса — 46 936[4].

Послідовність амінокислот
1020304050
MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF
QFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRR
SQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKG
AVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSIT
VRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLG
SRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGA
RSNHLTSGVIEGLLSTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPL
PQEFTYLNSPTPGQLQPIYENVNVVSGDEVYSLAYYNQPEQESVAAETLG
THMEDKVSLDIYSRLRKANITDVDYEDAM

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Davis R.S., Wang Y.-H., Kubagawa H., Cooper M.D. (2001). Identification of a family of Fc receptor homologs with preferential B cell expression.. Proc. Natl. Acad. Sci. U.S.A. 98: 9772 — 9777.  PubMed DOI:10.1073/pnas.171308498
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Miller I., Hatzivassiliou G., Cattoretti G., Mendelsohn C., Dalla-Favera R. (2002). IRTAs: a new family of immunoglobulin-like receptors differentially expressed in B cells.. Blood 99: 2662 — 2669.  PubMed DOI:10.1182/blood.V99.8.2662
  • Leu C.-M., Davis R.S., Gartland L.A., Fine W.D., Cooper M.D. (2005). FcRH1: an activation coreceptor on human B cells.. Blood 105: 1121 — 1126.  PubMed DOI:10.1182/blood-2004-06-2344

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18509 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q96LA6 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]