FEZ1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FEZ1
Ідентифікатори
Символи FEZ1, UNC-76, fasciculation and elongation protein zeta 1
Зовнішні ІД MGI: 2670976 HomoloGene: 21063 GeneCards: FEZ1
Шаблон експресії
PBB GE FEZ1 203562 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005103
NM_022549
RefSeq (білок)
NP_005094
NP_072043
Локус (UCSC) Хр. 11: 125.44 – 125.59 Mb Хр. 9: 36.82 – 36.88 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FEZ1 (англ. Fasciculation and elongation protein zeta 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 392 амінокислот, а молекулярна маса — 45 119[4].

Послідовність амінокислот
1020304050
MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFS
SEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETL
QDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKS
ENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQA
DSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEEL
VQQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQ
SSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEK
KASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані.

Література[ред. | ред. код]

  • Bloom L., Horvitz H.R. (1997). The Caenorhabditis elegans gene unc-76 and its human homologs define a new gene family involved in axonal outgrowth and fasciculation.. Proc. Natl. Acad. Sci. U.S.A. 94: 3414 — 3419.  PubMed DOI:10.1073/pnas.94.7.3414
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Okumura F., Hatakeyama S., Matsumoto M., Kamura T., Nakayama K. (2004). Functional regulation of FEZ1 by the U-box-type ubiquitin ligase E4B contributes to neuritogenesis.. J. Biol. Chem. 279: 53533 — 53543.  PubMed DOI:10.1074/jbc.M402916200
  • Assmann E.M., Alborghetti M.R., Camargo M.E.R., Kobarg J. (2006). FEZ1 dimerization and interaction with transcription regulatory proteins involves its coiled-coil region.. J. Biol. Chem. 281: 9869 — 9881.  PubMed DOI:10.1074/jbc.M513280200
  • Lanza D.C., Trindade D.M., Assmann E.M., Kobarg J. (2008). Over-expression of GFP-FEZ1 causes generation of multi-lobulated nuclei mediated by microtubules in HEK293 cells.. Exp. Cell Res. 314: 2028 — 2039.  PubMed DOI:10.1016/j.yexcr.2008.02.012

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3659 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q99689 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]