FGD3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FGD3
Protein FGD3 PDB 2coc.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FGD3, ZFYVE5, FYVE, RhoGEF and PH domain containing 3
Зовнішні ІД OMIM: 617554 MGI: 1353657 HomoloGene: 22925 GeneCards: FGD3
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001083536
NM_001286993
NM_033086
NM_001369951
NM_001369952
NM_015759
RefSeq (білок)
н/д
Локус (UCSC) Хр. 9: 92.95 – 93.04 Mb Хр. 13: 49.26 – 49.32 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FGD3 (англ. FYVE, RhoGEF and PH domain containing 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 725 амінокислот, а молекулярна маса — 79 401[4].

Послідовність амінокислот
1020304050
MESGRGSSTPPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLA
AAGDGSPDIGPTGELSGSLKIPNRDSGIDSPSSSVAGENFPCEEGLEAGP
SPTVLGAHAEMALDSQVPKVTPQEEADSDVGEEPDSENTPQKADKDAGLA
QHSGPQKLLHIAQELLHTEETYVKRLHLLDQVFCTRLTDAGIPPEVIMGI
FSNISSIHRFHGQFLLPELKTRITEEWDTNPRLGDILQKLAPFLKMYGEY
VKNFDRAVGLVSTWTQRSPLFKDVVHSIQKQEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPQDAPDRKDAERSLELISTAANHSNAAIRKVEKMHK
LLEVYEQLGGEEDIVNPANELIKEGQIQKLSAKNGTPQDRHLFLFNSMIL
YCVPKLRLMGQKFSVREKMDISGLQVQDIVKPNTAHTFIITGRKRSLELQ
TRTEEEKKEWIQIIQATIEKHKQNSETFKAFGGAFSQDEDPSLSPDMPIT
STSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKSCGETFNSITK
RRHHCKLCGAVICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTEKTPTA
DPQPSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTI
PLPSCKLSVPDPEERLDSGHVWKLQWAKQSWYLSASSAELQQQWLETLST
AAHGDTAQDSPGALQLQVPMGAAAP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16027 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q5JSP0 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]