FSHB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FSHB
Protein FSHB PDB 1fl7.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FSHB, HH24, follicle stimulating hormone beta subunit, Follitropin subunit beta, follicle stimulating hormone subunit beta
Зовнішні ІД OMIM: 136530 MGI: 95582 HomoloGene: 430 GeneCards: FSHB
Пов'язані генетичні захворювання
hypogonadotropic hypogonadism 24 without anosmia[1]
Шаблон експресії
PBB GE FSHB 214489 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000510
NM_001018080
NM_008045
RefSeq (білок)
NP_000501
NP_001018090
NP_032071
Локус (UCSC) Хр. 11: 30.23 – 30.24 Mb Хр. 2: 107.06 – 107.06 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FSHB (англ. Follicle stimulating hormone beta subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 129 амінокислот, а молекулярна маса — 14 700[5].

Послідовність амінокислот
1020304050
MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYC
YTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQC
HCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Кодований геном білок за функцією належить до гормонів. Секретований назовні.

Література[ред. | ред. код]

  • Jameson J.L., Becker C.B., Lindell C.M., Habener J.F. (1988). Human follicle-stimulating hormone beta-subunit gene encodes multiple messenger ribonucleic acids.. Mol. Endocrinol. 2: 806 — 815.  PubMed DOI:10.1210/mend-2-9-806
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Shome B., Parlow A.F. (1974). Human follicle stimulating hormone: first proposal for the amino acid sequence of the hormone-specific, beta subunit (hFSHb).. J. Clin. Endocrinol. Metab. 39: 203 — 205.  PubMed DOI:10.1210/jcem-39-1-203
  • Fujiki Y., Rathnam P., Saxena B.B. (1980). Studies on the disulfide bonds in human pituitary follicle-stimulating hormone.. Biochim. Biophys. Acta 624: 428 — 435.  PubMed DOI:10.1016/0005-2795(80)90084-7
  • Fox K.M., Dias J.A., Van Roey P. (2001). Three-dimensional structure of human follicle-stimulating hormone.. Mol. Endocrinol. 15: 378 — 389.  PubMed DOI:10.1210/mend.15.3.0603
  • Fan Q.R., Hendrickson W.A. (2005). Structure of human follicle-stimulating hormone in complex with its receptor.. Nature 433: 269 — 277.  PubMed DOI:10.1038/nature03206

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]