GIF (ген)

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GIF (ген)
Ідентифікатори
Символи IFintrinsic factorINFgastric intrinsic factor (vitamin B synthesis)CBLIFGIFcobalamin binding intrinsic factorgastric intrinsic factor
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

GIF (англ. Gastric intrinsic factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 417 амінокислот, а молекулярна маса — 45 416[2].

Послідовність амінокислот
1020304050
MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSS
AYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALT
SSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEAT
LPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFG
QVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTT
DMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPS
NPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEA
QRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVA
DYIPFNHEHITANFTQY

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, альтернативний сплайсинг. Білок має сайт для зв'язування з кобальтом. Секретований назовні.

Література[ред. | ред. код]

  • Hewitt J.E., Gordon M.M., Taggart R.T., Mohandas T.K., Alpers D.H. (1991). Human gastric intrinsic factor: characterization of cDNA and genomic clones and localization to human chromosome 11.. Genomics 10: 432 — 440.  PubMed DOI:10.1016/0888-7543(91)90329-D
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Andersen C.B., Madsen M., Storm T., Moestrup S.K., Andersen G.R. (2010). Structural basis for receptor recognition of vitamin-B(12)-intrinsic factor complexes.. Nature 464: 445 — 448.  PubMed DOI:10.1038/nature08874

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:4268 (англ.). Процитовано 8 вересня 2017. 
  2. UniProt, P27352 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]