IL17F

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IL17F
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IL17F, CANDF6, IL-17F, ML-1, ML1, interleukin 17F
Зовнішні ІД OMIM: 606496 MGI: 2676631 HomoloGene: 17115 GeneCards: IL17F
Пов'язані генетичні захворювання
рак підшлункової залози[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_052872
NM_145856
RefSeq (білок)
NP_443104
NP_665855
Локус (UCSC) Хр. 6: 52.24 – 52.24 Mb Хр. 1: 20.78 – 20.79 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IL17F (англ. Interleukin 17F) – білок, який кодується однойменним геном, розташованим у людей на 6-ї хромосомі.[4] Довжина поліпептидного ланцюга білка становить 163 амінокислот, а молекулярна маса — 18 045[5].

Послідовність амінокислот
1020304050
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPV
PGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQA
QCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTV
GCTCVTPVIHHVQ

Кодований геном білок за функцією належить до цитокінів. Секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504
  • Ely L.K., Fischer S., Garcia K.C. (2009). Structural basis of receptor sharing by interleukin 17 cytokines.. Nat. Immunol. 10: 1245 — 1251.  PubMed DOI:10.1038/ni.1813

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]