IL1RAP

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IL1RAP
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IL1RAP, C3orf13, IL-1RAcP, IL1R3, interleukin 1 receptor accessory protein
Зовнішні ІД OMIM: 602626 MGI: 104975 HomoloGene: 1643 GeneCards: IL1RAP
Пов'язані генетичні захворювання
рак легень[1]
Шаблон експресії
PBB GE IL1RAP 205227 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001159317
NM_001159318
NM_008364
NM_134103
RefSeq (білок)
NP_001152789
NP_001152790
NP_032390
NP_598864
Локус (UCSC) Хр. 3: 190.51 – 190.66 Mb Хр. 16: 26.58 – 26.73 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IL1RAP (англ. Interleukin 1 receptor accessory protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 570 амінокислот, а молекулярна маса — 65 418[5].

Послідовність амінокислот
1020304050
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLF
EHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLW
FRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLY
IEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFL
IALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPND
HVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQK
VPAPRYTVELACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETIL
DGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIV
TDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENMASRGNINVIL
VQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKK
SPRRSSSDEQGLSYSSLKNV

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, запальна відповідь, поліморфізм, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.

Література[ред. | ред. код]

  • Huang J., Gao X., Li S., Cao Z. (1997). Recruitment of IRAK to the interleukin 1 receptor complex requires interleukin 1 receptor accessory protein.. Proc. Natl. Acad. Sci. U.S.A. 94: 12829 — 12832.  PubMed DOI:10.1073/pnas.94.24.12829
  • Jensen L.E., Muzio M., Mantovani A., Whitehead A.S. (2000). IL-1 signaling cascade in liver cells and the involvement of a soluble form of the IL-1 receptor accessory protein.. J. Immunol. 164: 5277 — 5286.  PubMed DOI:10.4049/jimmunol.164.10.5277
  • Jensen L.E., Whitehead A.S. (2003). Expression of alternatively spliced interleukin-1 receptor accessory protein mRNAs is differentially regulated during inflammation and apoptosis.. Cell. Signal. 15: 793 — 802.  PubMed DOI:10.1016/S0898-6568(03)00039-1
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Dale M., Hammond D.W., Cox A., Nicklin M.J.H. (1998). The human gene encoding the interleukin-1 receptor accessory protein (IL1RAP) maps to chromosome 3q28 by fluorescence in situ hybridization and radiation hybrid mapping.. Genomics 47: 325 — 326.  PubMed DOI:10.1006/geno.1997.5113

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]