ITGA9

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ITGA9
Ідентифікатори
Символи ITGA9, ALPHA-RLC, ITGA4L, RLC, integrin subunit alpha 9
Зовнішні ІД OMIM: 603963 MGI: 104756 HomoloGene: 1664 GeneCards: ITGA9
Пов'язані генетичні захворювання
бічний аміотрофічний склероз, nasopharynx carcinoma[1]
Шаблон експресії
PBB GE ITGA9 gnf1h04097 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002207
NM_001113514
NM_133721
RefSeq (білок)
NP_002198
NP_001106986
NP_598482
Локус (UCSC) Хр. 3: 37.45 – 37.82 Mb Хр. 9: 118.61 – 118.9 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ITGA9 (англ. Integrin subunit alpha 9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 1 035 амінокислот, а молекулярна маса — 114 489[5].

Послідовність амінокислот
1020304050
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGY
AVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTEL
DMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIY
YEADHILPHGFCYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAGIAG
FFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIMNRRYTYLGYA
VTAGHFSHPSTIDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEE
QLALTGDGAYNAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYH
GDAGGIVPQYSMKLSGQKINPVLRMFGQSISGGIDMDGNGYPDVTVGAFM
SDSVVLLRARPVITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSF
HGKHVPGEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTY
MEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGKLLLSSMDEKTLYLALG
AVKNISLNISISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLE
SDFLKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEEVLSFIVTAQSGNTER
SESLHDNTLVLMVPLMHEVDTSITGIMSPTSFVYGESVDAANFIQLDDLE
CHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVVGQ
EKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALR
VVEIAHGNPEEVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVL
LWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKNQ

Кодований геном білок за функціями належить до рецепторів, інтегринів. Задіяний у таких біологічних процесах як клітинна адгезія, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у мембрані.

Література[ред. | ред. код]

  • Palmer E.L., Rueegg C., Ferrando R., Pytela R., Sheppard D. (1993). Sequence and tissue distribution of the integrin alpha 9 subunit, a novel partner of beta 1 that is widely distributed in epithelia and muscle.. J. Cell Biol. 123: 1289 — 1297.  PubMed DOI:10.1083/jcb.123.5.1289

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]