LHB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
LHB
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи LHB, CGB4, LSH-B, hHH23, Luteinizing hormone beta polypeptide, LSH-beta, Luteinizing hormone subunit beta
Зовнішні ІД MGI: 96782 HomoloGene: 81806 GeneCards: LHB
Шаблон експресії
PBB GE LHB 214471 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000894
NM_008497
RefSeq (білок)
NP_000885
NP_032523
Локус (UCSC) Хр. 19: 49.02 – 49.02 Mb Хр. 7: 45.42 – 45.42 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

LHB (англ. Luteinizing hormone beta polypeptide) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 141 амінокислот, а молекулярна маса — 15 345[4].

Послідовність амінокислот
1020304050
MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVN
TTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVV
SFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL

Кодований геном білок за функцією належить до гормонів. Секретований назовні.

Література[ред. | ред. код]

  • Talmadge K., Vamvakopoulos N.C., Fiddes J.C. (1984). Evolution of the genes for the beta subunits of human chorionic gonadotropin and luteinizing hormone.. Nature 307: 37 — 40.  PubMed DOI:10.1038/307037a0
  • Shome B., Parlow A.F. (1973). The primary structure of the hormone-specific, beta subunit of human pituitary luteinizing hormone (hLH).. J. Clin. Endocrinol. Metab. 36: 618 — 621.  PubMed DOI:10.1210/jcem-36-3-618
  • Closset J., Hennen G., Lequin R.M. (1973). Human luteinizing hormone. The amino acid sequence of the subunit.. FEBS Lett. 29: 97 — 100.  PubMed DOI:10.1016/0014-5793(73)80534-4
  • Weisshaar G., Hiyama J., Renwick A.G.C., Nimtz M. (1991). NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin.. Eur. J. Biochem. 195: 257 — 268.  PubMed DOI:10.1111/j.1432-1033.1991.tb15702.x
  • Keutmann H.T., Hua Q.-X., Weiss M.A. (1992). Structure of a receptor-binding fragment from human luteinizing hormone beta-subunit determined by [1H]- and [15N]nuclear magnetic resonance spectroscopy.. Mol. Endocrinol. 6: 904 — 913.  PubMed DOI:10.1210/mend.6.6.1495492
  • Liao W.X., Roy A.C., Chan C., Arulkumaran S., Ratnam S.S. (1998). A new molecular variant of luteinizing hormone associated with female infertility.. Fertil. Steril. 69: 102 — 106.  PubMed DOI:10.1016/S0015-0282(97)00445-7

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6584 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P01229 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]