MUC17

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MUC17
Ідентифікатори
Символи MUC17, MUC3, MUC-17, MUC-3, mucin 17, cell surface associated
Зовнішні ІД OMIM: 608424 HomoloGene: 134646 GeneCards: MUC17
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001004430
NM_001040105
н/д
RefSeq (білок)
NP_001035194
н/д
Локус (UCSC) Хр. 7: 101.02 – 101.06 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

MUC17 (англ. Mucin 17, cell surface associated) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 4 493 амінокислот, а молекулярна маса — 451 741[3].

Послідовність амінокислот
1020304050
MPRPGTMALCLLTLVLSLLPPQAAAEQDLSVNRAVWDGGGCISQGDVLNR
QCQQLSQHVRTGSAANTATGTTSTNVVEPRMYLSCSTNPEMTSIESSVTS
DTPGVSSTRMTPTESRTTSESTSDSTTLFPSSTEDTSSPTTPEGTDVPMS
TPSEESISSTMAFVSTAPLPSFEAYTSLTYKVDMSTPLTTSTQASSSPTT
PESTTIPKSTNSEGSTPLTSMPASTMKVASSEAITLLTTPVEISTPVTIS
AQASSSPTTAEGPSLSNSAPSGGSTPLTRMPLSVMLVVSSEASTLSTTPA
ATNIPVITSTEASSSPTTAEGTSIPTSTYTEGSTPLTSTPASTMPVATSE
MSTLSITPVDTSTLVTTSTEPSSLPTTAEATSMLTSTLSEGSTPLTNMPV
STILVASSEASTTSTIPVDSKTFVTTASEASSSPTTAEDTSIATSTPSEG
STPLTSMPVSTTPVASSEASNLSTTPVDSKTQVTTSTEASSSPPTAEVNS
MPTSTPSEGSTPLTSMSVSTMPVASSEASTLSTTPVDTSTPVTTSSEASS
SSTTPEGTSIPTSTPSEGSTPLTNMPVSTRLVVSSEASTTSTTPADSNTF
VTTSSEASSSSTTAEGTSMPTSTYSERGTTITSMSVSTTLVASSEASTLS
TTPVDSNTPVTTSTEATSSSTTAEGTSMPTSTYTEGSTPLTSMPVNTTLV
ASSEASTLSTTPVDTSTPVTTSTEASSSPTTADGASMPTSTPSEGSTPLT
SMPVSKTLLTSSEASTLSTTPLDTSTHITTSTEASCSPTTTEGTSMPIST
PSEGSPLLTSIPVSITPVTSPEASTLSTTPVDSNSPVTTSTEVSSSPTPA
EGTSMPTSTYSEGRTPLTSMPVSTTLVATSAISTLSTTPVDTSTPVTNST
EARSSPTTSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSSEARTLSATPVD
TSTPVTTSTEATSSPTTAEGTSIPTSTPSEGTTPLTSTPVSHTLVANSEA
STLSTTPVDSNTPLTTSTEASSPPPTAEGTSMPTSTPSEGSTPLTRMPVS
TTMVASSETSTLSTTPADTSTPVTTYSQASSSSTTADGTSMPTSTYSEGS
TPLTSVPVSTRLVVSSEASTLSTTPVDTSIPVTTSTEASSSPTTAEGTSI
PTSPPSEGTTPLASMPVSTTLVVSSEANTLSTTPVDSKTQVATSTEASSP
PPTAEVTSMPTSTPGERSTPLTSMPVRHTPVASSEASTLSTSPVDTSTPV
TTSAETSSSPTTAEGTSLPTSTTSEGSTLLTSIPVSTTLVTSPEASTLLT
TPVDTKGPVVTSNEVSSSPTPAEGTSMPTSTYSEGRTPLTSIPVNTTLVA
SSAISILSTTPVDNSTPVTTSTEACSSPTTSEGTSMPNSNPSEGTTPLTS
IPVSTTPVVSSEASTLSATPVDTSTPGTTSAEATSSPTTAEGISIPTSTP
SEGKTPLKSIPVSNTPVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPAE
GTSIAISTPSEGSTALTSIPVSTTTVASSEINSLSTTPAVTSTPVTTYSQ
ASSSPTTADGTSMQTSTYSEGSTPLTSLPVSTMLVVSSEANTLSTTPIDS
KTQVTASTEASSSTTAEGSSMTISTPSEGSPLLTSIPVSTTPVASPEAST
LSTTPVDSNSPVITSTEVSSSPTPAEGTSMPTSTYTEGRTPLTSITVRTT
PVASSAISTLSTTPVDNSTPVTTSTEARSSPTTSEGTSMPNSTPSEGTTP
LTSIPVSTTPVLSSEASTLSATPIDTSTPVTTSTEATSSPTTAEGTSIPT
STLSEGMTPLTSTPVSHTLVANSEASTLSTTPVDSNSPVVTSTAVSSSPT
PAEGTSIATSTPSEGSTALTSIPVSTTTVASSETNTLSTTPAVTSTPVTT
YAQVSSSPTTADGSSMPTSTPREGRPPLTSIPVSTTTVASSEINTLSTTL
ADTRTPVTTYSQASSSPTTADGTSMPTPAYSEGSTPLTSMPLSTTLVVSS
EASTLSTTPVDTSTPATTSTEGSSSPTTAGGTSIQTSTPSERTTPLAGMP
VSTTLVVSSEGNTLSTTPVDSKTQVTNSTEASSSATAEGSSMTISAPSEG
SPLLTSIPLSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPIPTEGTS
MQTSTYSDRRTPLTSMPVSTTVVASSAISTLSTTPVDTSTPVTNSTEARS
SPTTSEGTSMPTSTPSEGSTPFTSMPVSTMPVVTSEASTLSATPVDTSTP
VTTSTEATSSPTTAEGTSIPTSTLSEGTTPLTSIPVSHTLVANSEVSTLS
TTPVDSNTPFTTSTEASSPPPTAEGTSMPTSTSSEGNTPLTRMPVSTTMV
ASFETSTLSTTPADTSTPVTTYSQAGSSPTTADDTSMPTSTYSEGSTPLT
SVPVSTMPVVSSEASTHSTTPVDTSTPVTTSTEASSSPTTAEGTSIPTSP
PSEGTTPLASMPVSTTPVVSSEAGTLSTTPVDTSTPMTTSTEASSSPTTA
EDIVVPISTASEGSTLLTSIPVSTTPVASPEASTLSTTPVDSNSPVVTST
EISSSATSAEGTSMPTSTYSEGSTPLRSMPVSTKPLASSEASTLSTTPVD
TSIPVTTSTETSSSPTTAKDTSMPISTPSEVSTSLTSILVSTMPVASSEA
STLSTTPVDTRTLVTTSTGTSSSPTTAEGSSMPTSTPGERSTPLTNILVS
TTLLANSEASTLSTTPVDTSTPVTTSAEASSSPTTAEGTSMRISTPSDGS
TPLTSILVSTLPVASSEASTVSTTAVDTSIPVTTSTEASSSPTTAEVTSM
PTSTPSETSTPLTSMPVNHTPVASSEAGTLSTTPVDTSTPVTTSTKASSS
PTTAEGIVVPISTASEGSTLLTSIPVSTTPVASSEASTLSTTPVDTSIPV
TTSTEGSSSPTTAEGTSMPISTPSEVSTPLTSILVSTVPVAGSEASTLST
TPVDTRTPVTTSAEASSSPTTAEGTSMPISTPGERRTPLTSMSVSTMPVA
SSEASTLSRTPADTSTPVTTSTEASSSPTTAEGTGIPISTPSEGSTPLTS
IPVSTTPVAIPEASTLSTTPVDSNSPVVTSTEVSSSPTPAEGTSMPISTY
SEGSTPLTGVPVSTTPVTSSAISTLSTTPVDTSTPVTTSTEAHSSPTTSE
GTSMPTSTPSEGSTPLTYMPVSTMLVVSSEDSTLSATPVDTSTPVTTSTE
ATSSTTAEGTSIPTSTPSEGMTPLTSVPVSNTPVASSEASILSTTPVDSN
TPLTTSTEASSSPPTAEGTSMPTSTPSEGSTPLTSMPVSTTTVASSETST
LSTTPADTSTPVTTYSQASSSPPIADGTSMPTSTYSEGSTPLTNMSFSTT
PVVSSEASTLSTTPVDTSTPVTTSTEASLSPTTAEGTSIPTSSPSEGTTP
LASMPVSTTPVVSSEVNTLSTTPVDSNTLVTTSTEASSSPTIAEGTSLPT
STTSEGSTPLSIMPLSTTPVASSEASTLSTTPVDTSTPVTTSSPTNSSPT
TAEVTSMPTSTAGEGSTPLTNMPVSTTPVASSEASTLSTTPVDSNTFVTS
SSQASSSPATLQVTTMRMSTPSEGSSSLTTMLLSSTYVTSSEASTPSTPS
VDRSTPVTTSTQSNSTPTPPEVITLPMSTPSEVSTPLTIMPVSTTSVTIS
EAGTASTLPVDTSTPVITSTQVSSSPVTPEGTTMPIWTPSEGSTPLTTMP
VSTTRVTSSEGSTLSTPSVVTSTPVTTSTEAISSSATLDSTTMSVSMPME
ISTLGTTILVSTTPVTRFPESSTPSIPSVYTSMSMTTASEGSSSPTTLEG
TTTMPMSTTSERSTLLTTVLISPISVMSPSEASTLSTPPGDTSTPLLTST
KAGSFSIPAEVTTIRISITSERSTPLTTLLVSTTLPTSFPGASIASTPPL
DTSTTFTPSTDTASTPTIPVATTISVSVITEGSTPGTTIFIPSTPVTSST
ADVFPATTGAVSTPVITSTELNTPSTSSSSTTTSFSTTKEFTTPAMTTAA
PLTYVTMSTAPSTPRTTSRGCTTSASTLSATSTPHTSTSVTTRPVTPSSE
SSRPSTITSHTIPPTFPPAHSSTPPTTSASSTTVNPEAVTTMTTRTKPST
RTTSFPTVTTTAVPTNTTIKSNPTSTPTVPRTTTCFGDGCQNTASRCKNG
GTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFT
EELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHD
VLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTG
TQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVS
KNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSLVYGLVGAGVV
LMLIILVALLMLVFRSKREVKRQKYRLSQLYKWQEEDSGPAPGTFQNIGF
DICQDDDSIHLESIYSNFQPSLRHIDPETKIRIQRPQVMTTSF

Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.

Література[ред. | ред. код]

  • Moniaux N., Junker W.M., Singh A.P., Jones A.M., Batra S.K. (2006). Characterization of human mucin MUC17. Complete coding sequence and organization.. J. Biol. Chem. 281: 23676 — 23685.  PubMed DOI:10.1074/jbc.M600302200
  • Gum J.R. Jr., Crawley S.C., Hicks J.W., Szymkowski D.E., Kim Y.S. (2002). MUC17, a novel membrane-tethered mucin.. Biochem. Biophys. Res. Commun. 291: 466 — 475.  PubMed DOI:10.1006/bbrc.2002.6475

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:16800 (англ.). Процитовано 7 вересня 2017. 
  3. UniProt, Q685J3 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]