PLCE1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PLCE1
Protein PLCE1 PDB 2bye.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PLCE1, NPHS3, PLCE, PPLC, phospholipase C epsilon 1
Зовнішні ІД OMIM: 608414 MGI: 1921305 HomoloGene: 9478 GeneCards: PLCE1
Пов'язані генетичні захворювання
dengue shock syndrome, артеріальна гіпертензія, хронічне обструктивне захворювання легень, рак стравоходу[1]
Шаблон експресії
PBB GE PLCE1 205112 at fs.png

PBB GE PLCE1 205111 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001165979
NM_001288989
NM_016341
NM_019588
RefSeq (білок)
NP_001159451
NP_001275918
NP_057425
NP_062534
Локус (UCSC) Хр. 10: 94.03 – 94.33 Mb Хр. 19: 38.48 – 38.79 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PLCE1 (англ. Phospholipase C epsilon 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 2 302 амінокислот, а молекулярна маса — 258 715[5].

Послідовність амінокислот
1020304050
MTSEEMTASVLIPVTQRKVVSAQSAADESSEKVSDINISKAHTVRRSGET
SHTISQLNKLKEEPSGSNLPKILSIAREKIVSDENSNEKCWEKIMPDSAK
NLNINCNNILRNHQHGLPQRQFYEMYNSVAEEDLCLETGIPSPLERKVFP
GIQLELDRPSMGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDT
FCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQ
LQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKTFLSHF
EDFPDNCDDVEEDAFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRT
LPSGHIGLTAWSYIDQKRNGPLLPCGRVMEPPSTVEIRQDGSQRLSEAQW
YPIYNAVRREETENTVGSLLHFLTKLPASETAHGRISVGPCLKQCVRDTV
CEYRATLQRTSISQYITGSLLEATTSLGARSGLLSTFGGSTGRMMLKERQ
PGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILMEQEQTIYRRV
LPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMR
FNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAG
LRSRKVLKMWQFMDQSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGC
KVVPFCGVFLKELCEVLDGASGLMKLCPRYNSQEETLEFVADYSGQDNFL
QRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDSPSEGNSSRKSSL
KDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHGTELIPWYV
LSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTAS
PASSKAKLGVLNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPG
IDIHTVCVQNKLGSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFS
GLLELTRAVRKMRKFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFG
GRRWSARNPSPGTSAKNAEKPNMQRNNTLGISTTKKKKKILMRGESGEVT
DDEMATRKAKMHKECRSRSGSDPQDINEQEESEVNAIANPPNPLPSRRAH
SLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGM
KGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSE
SAPLYTNLTIDENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISD
AIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGEHCTYDEILSII
QKFEPSISMCHQGLMSFEGFARFLMDKENFASKNDESQENIKELQLPLSY
YYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPII
YHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEI
FKTVFGEKLVTKFLFETDFSDDPMLPSPDQLRKKVLLKNKKLKAHQTPVD
ILKQKAHQLASMQVQAYNGGNANPRPANNEEEEDEEDEYDYDYESLSDDN
ILEDRPENKSCNDKLQFEYNEEIPKRIKKADNSACNKGKVYDMELGEEFY
LDQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNASGSSRGKERKSRKSI
FGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLNPTTSLSAIIR
TPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPN
PLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNC
PMYQKFSPLERDLDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMP
LDSCHFRTKPIHRNTLNPMWNEQFLFHVHFEDLVFLRFAVVENNSSAVTA
QRIIPLKALKRGYRHLQLRNLHNEVLEISSLFINSRRMEENSSGNTMSAS
SMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQ
DIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPE
EGYMGRIVLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPR
TVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNK
KTTTPKSSQRVLLDQECVFQAQSKWKGAGKFILKLKEQVQASREDKKKGI
SFASELKKLTKSTKQPRGLTSPSQLLTSESIQTKEEKPVGGLSSSDTMDY
RQ

Кодований геном білок за функціями належить до гідролаз, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у таких біологічних процесах, як метаболізм ліпідів, деградація ліпідів, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у клітинній мембрані, цитоплазмі, мембрані, апараті гольджі.

Література[ред. | ред. код]

  • Lopez I., Mak E.C., Ding J., Hamm H.E., Lomasney J.W. (2001). A novel bifunctional phospholipase C that is regulated by Galpha 12 and stimulates the Ras/mitogen-activated protein kinase pathway.. J. Biol. Chem. 276: 2758 — 2765.  PubMed DOI:10.1074/jbc.M008119200
  • Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 143 — 150.  PubMed DOI:10.1093/dnares/7.2.143
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Sorli S.C., Bunney T.D., Sugden P.H., Paterson H.F., Katan M. (2005). Signaling properties and expression in normal and tumor tissues of two phospholipase C epsilon splice variants.. Oncogene 24: 90 — 100.  PubMed DOI:10.1038/sj.onc.1208168
  • Ada-Nguema A.S., Xenias H., Sheetz M.P., Keely P.J. (2006). The small GTPase R-Ras regulates organization of actin and drives membrane protrusions through the activity of PLCepsilon.. J. Cell Sci. 119: 1307 — 1319.  PubMed DOI:10.1242/jcs.02835

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]