PTPRM

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PTPRM
Protein PTPRM PDB 1rpm.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PTPRM, PTPRL1, R-PTP-MU, RPTPM, RPTPU, hR-PTPu, protein tyrosine phosphatase, receptor type M, protein tyrosine phosphatase receptor type M
Зовнішні ІД MGI: 102694 HomoloGene: 37694 GeneCards: PTPRM
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001105244
NM_002845
NM_008984
NM_001357625
RefSeq (білок)
NP_001098714
NP_002836
NP_033010
NP_001344554
Локус (UCSC) Хр. 18: 7.57 – 8.41 Mb Хр. 17: 66.67 – 67.35 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PTPRM (англ. Protein tyrosine phosphatase, receptor type M) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 452 амінокислот, а молекулярна маса — 163 682[4].

Послідовність амінокислот
1020304050
MRGLGTCLATLAGLLLTAAGETFSGGCLFDEPYSTCGYSQSEGDDFNWEQ
VNTLTKPTSDPWMPSGSFMLVNASGRPEGQRAHLLLPQLKENDTHCIDFH
YFVSSKSNSPPGLLNVYVKVNNGPLGNPIWNISGDPTRTWNRAELAISTF
WPNFYQVIFEVITSGHQGYLAIDEVKVLGHPCTRTPHFLRIQNVEVNAGQ
FATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRRFIASFNVVNT
TKRDAGKYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYE
ISVLLTRPGEGGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRW
EPFGYNVTRCHSYNLTVHYCYQVGGQEQVREEVSWDTENSHPQHTITNLS
PYTNVSVKLILMNPEGRKESQELIVQTDEDLPGAVPTESIQGSTFEEKIF
LQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVSKLGNETHFLF
FGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQT
DNTVTVMLKPAHSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQ
NASLLNSQYYFAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPYKSYRI
YFQAASRANGETKIDCVQVATKGAATPKPVPEPEKQTDHTVKIAGVIAGI
LLFVIIFLGVVLVMKKRKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGT
NCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSYYPDETHTMAS
DTSSLVQSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGF
KEEYESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTN
SDYINGNYIDGYHRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNL
VEVGRVKCCKYWPDDTEIYKDIKVTLIETELLAEYVIRTFAVEKRGVHEI
REIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKSPPSAGPLVVHCSAGAG
RTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDA
ILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTL
RVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDS
YKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWP
ENGVHRHGPIQVEFVSADLEEDIISRIFRIYNAARPQDGYRMVQQFQFLG
WPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGGGRSGTFC
AISIVCEMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLN
SG

Кодований геном білок за функціями належить до гідролаз, рецепторів, протеїн-фосфатаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинна адгезія, альтернативний сплайсинг. Локалізований у мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hoffmann K.M., Tonks N.K., Barford D. (1997). The crystal structure of domain 1 of receptor protein-tyrosine phosphatase mu.. J. Biol. Chem. 272: 27505 — 27508.  PubMed DOI:10.1074/jbc.272.44.27505

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9675 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P28827 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]