RGL2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RGL2
Protein RGL2 PDB 1rlf.png
Ідентифікатори
Символи RGL2, HKE1.5, KE1.5, RAB2L, ral guanine nucleotide dissociation stimulator like 2
Зовнішні ІД OMIM: 602306 MGI: 107483 HomoloGene: 3494 GeneCards: RGL2
Шаблон експресії
PBB GE RGL2 209110 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243738
NM_004761
NM_009059
RefSeq (білок)
NP_001230667
NP_004752
NP_033085
Локус (UCSC) Хр. 6: 33.29 – 33.3 Mb Хр. 17: 33.93 – 33.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RGL2 (англ. Ral guanine nucleotide dissociation stimulator like 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 777 амінокислот, а молекулярна маса — 83 549[4].

Послідовність амінокислот
1020304050
MLPRPLRLLLDTSPPGGVVLSSFRSRDPEEGGGPGGLVVGGGQEEEEEEE
EEAPVSVWDEEEDGAVFTVTSRQYRPLDPLVPMPPPRSSRRLRAGTLEAL
VRHLLDTRTSGTDVSFMSAFLATHRAFTSTPALLGLMADRLEALESHPTD
ELERTTEVAISVLSTWLASHPEDFGSEAKGQLDRLESFLLQTGYAAGKGV
GGGSADLIRNLRSRVDPQAPDLPKPLALPGDPPADPTDVLVFLADHLAEQ
LTLLDAELFLNLIPSQCLGGLWGHRDRPGHSHLCPSVRATVTQFNKVAGA
VVSSVLGATSTGEGPGEVTIRPLRPPQRARLLEKWIRVAEECRLLRNFSS
VYAVVSALQSSPIHRLRAAWGEATRDSLRVFSSLCQIFSEEDNYSQSREL
LVQEVKLQSPLEPHSKKAPRSGSRGGGVVPYLGTFLKDLVMLDAASKDEL
ENGYINFDKRRKEFAVLSELRRLQNECRGYNLQPDHDIQRWLQGLRPLTE
AQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWTEVLGSVGVPTPLVSCD
RPSTGGDEAPTTPAPLLTRLAQHMKWPSVSSLDSALESSPSLHSPADPSH
LSPPASSPRPSRGHRRSASCGSPLSGGAEEASGGTGYGGEGSGPGASDCR
IIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELV
QLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGVTSGPSAS
GTPPSEGGGGSFPRIKATGRKIARALF

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг.

Література[ред. | ред. код]

  • Herberg J.A., Beck S., Trowsdale J. (1998). TAPASIN, DAXX, RGL2, HKE2 and four new genes (BING 1, 3 to 5) form a dense cluster at the centromeric end of the MHC.. J. Mol. Biol. 277: 839 — 857.  PubMed DOI:10.1006/jmbi.1998.1637
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Isomura M., Okui K., Fujiwara T., Shin S., Nakamura Y. (1996). Isolation and mapping of RAB2L, a human cDNA that encodes a protein homologous to RalGDS.. Cytogenet. Cell Genet. 74: 263 — 265.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9769 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, O15211 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]