SLC6A3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SLC6A3
Ідентифікатори
Символи DA transportersodium-dependent dopamine transportersolute carrier family 6 (neurotransmitter transporterdopamine)member 3solute carrier family 6 (neurotransmitter transporter)member 3dopamine transporter 1SLC6A3
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE SLC6A3 206836 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

SLC6A3 (англ. Solute carrier family 6 member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 620 амінокислот, а молекулярна маса — 68 495[2].

Послідовність амінокислот
1020304050
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNP
RQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLV
PYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKGVGFTVILISL
YVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGD
SSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLVLVIVL
LYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTT
SINSLTSFSSGFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIAT
LPLSSAWAVVFFIMLLTLGIDSAMGGMESVITGLIDEFQLLHRHRELFTL
FIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGVAWFYG
VGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYGA
YIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV

Задіяний у таких біологічних процесах як транспорт, симпортний транспорт, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном натрію. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • Vandenbergh D.J., Persico A.M., Uhl G.R. (1992). A human dopamine transporter cDNA predicts reduced glycosylation, displays a novel repetitive element and provides racially-dimorphic TaqI RFLPs.. Brain Res. Mol. Brain Res. 15: 161 — 166.  PubMed DOI:10.1016/0169-328X(92)90165-8
  • Kawarai T., Kawakami H., Yamamura Y., Nakamura S. (1997). Structure and organization of the gene encoding human dopamine transporter.. Gene 195: 11 — 18.  PubMed DOI:10.1016/S0378-1119(97)00131-5
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Torres G.E., Sweeney A.L., Beaulieu J.M., Shashidharan P., Caron M.G. (2004). Effect of torsinA on membrane proteins reveals a loss of function and a dominant-negative phenotype of the dystonia-associated DeltaE-torsinA mutant.. Proc. Natl. Acad. Sci. U.S.A. 101: 15650 — 15655.  PubMed DOI:10.1073/pnas.0308088101
  • Pristupa Z.B., Wilson J.M., Hoffman B.J., Kish S.J., Niznik H.B. (1994). Pharmacological heterogeneity of the cloned and native human dopamine transporter: disassociation of [3H]WIN 35,428 and [3H]GBR 12,935 binding.. Mol. Pharmacol. 45: 125 — 135.  PubMed
  • Hastrup H., Karlin A., Javitch J.A. (2001). Symmetrical homodimer of the human dopamine transporter revealed by cross-linking Cys306 at the extracellular end of TM6.. Abstr. - Soc. Neurosci. 27: 1866 — 1866. 

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:11049 (англ.). Процитовано 31 серпня 2017. 
  2. UniProt, Q01959 (англ.). Процитовано 31 серпня 2017. 

Див. також[ред. | ред. код]