SP1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SP1
Protein SP1 PDB 1sp1.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SP1, entrez:6667, Sp1 transcription factor
Зовнішні ІД OMIM: 189906 MGI: 98372 HomoloGene: 8276 GeneCards: SP1
Шаблон експресії
PBB GE SP1 214732 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001251825
NM_003109
NM_138473
NM_013672
RefSeq (білок)
NP_001238754
NP_003100
NP_612482
NP_038700
Локус (UCSC) Хр. 12: 53.38 – 53.42 Mb Хр. 15: 102.41 – 102.44 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SP1 (англ. Sp1 transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 785 амінокислот, а молекулярна маса — 80 693[4].

Послідовність амінокислот
1020304050
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTG
GGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQL
SQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVA
AAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDG
SGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQT
QYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVT
SGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTN
SQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQIL
IQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPII
IRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNT
TLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGL
PLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTR
REACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWH
TGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDH
LSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVA
MEAICPEGIARLANSGINVMQVADLQSINISGNGF

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, біологічні ритми, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Takahara T., Kanazu S., Yanagisawa S., Akanuma H. (2000). Heterogeneous Sp1 mRNAs in human HepG2 cells include a product of homotypic trans-splicing.. J. Biol. Chem. 275: 38067 — 38072.  PubMed DOI:10.1074/jbc.M002010200
  • Kadonaga J.T., Carner K.R., Masiarz F.R., Tjian R. (1987). Isolation of cDNA encoding transcription factor Sp1 and functional analysis of the DNA binding domain.. Cell 51: 1079 — 1090.  PubMed DOI:10.1016/0092-8674(87)90594-0
  • Jackson S.P., Tjian R. (1988). O-glycosylation of eukaryotic transcription factors: implications for mechanisms of transcriptional regulation.. Cell 55: 125 — 133.  PubMed DOI:10.1016/0092-8674(88)90015-3
  • Courey A.J., Tjian R. (1988). Analysis of Sp1 in vivo reveals multiple transcriptional domains, including a novel glutamine-rich activation motif.. Cell 55: 887 — 898.  PubMed DOI:10.1016/0092-8674(88)90144-4
  • Wang L., Mukherjee S., Jia F., Narayan O., Zhao L.J. (1995). Interaction of virion protein Vpr of human immunodeficiency virus type 1 with cellular transcription factor Sp1 and trans-activation of viral long terminal repeat.. J. Biol. Chem. 270: 25564 — 25569.  PubMed DOI:10.1074/jbc.270.43.25564

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11205 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P08047 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]