Туберин

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TSC2
Ідентифікатори
Символи TSC2, LAM, PPP1R160, TSC4, tuberous sclerosis 2, TSC complex subunit 2
Зовнішні ІД MGI: 102548 HomoloGene: 462 GeneCards: TSC2
Пов'язані генетичні захворювання
Ожиріння[1]
Шаблон експресії
PBB GE TSC2 215735 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
н/д
Локус (UCSC) н/д Хр. 17: 24.6 – 24.63 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TSC2 (англ. TSC complex subunit 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 807 амінокислот, а молекулярна маса — 200 608[5].

Послідовність амінокислот
1020304050
MAKPTSKDSGLKEKFKILLGLGTPRPNPRSAEGKQTEFIITAEILRELSM
ECGLNNRIRMIGQICEVAKTKKFEEHAVEALWKAVADLLQPERPLEARHA
VLALLKAIVQGQGERLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNG
RHITYLEEELADFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIARMVQ
MICLLCVRTASSVDIEVSLQVLDAVVCYNCLPAESLPLFIVTLCRTINVK
ELCEPCWKLMRNLLGTHLGHSAIYNMCHLMEDRAYMEDAPLLRGAVFFVG
MALWGAHRLYSLRNSPTSVLPSFYQAMACPNEVVSYEIVLSITRLIKKYR
KELQVVAWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEF
HGSQERYFELVERCADQRPESSLLNLISYRAQSIHPAKDGWIQNLQALME
RFFRSESRGAVRIKVLDVLSFVLLINRQFYEEELINSVVISQLSHIPEDK
DHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLSPPPELEERDV
AAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKH
SYTLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCVCDYME
PERGSEKKTSGPLSPPTGPPGPAPAGPAVRLGSVPYSLLFRVLLQCLKQE
SDWKVLKLVLGRLPESLRYKVLIFTSPCSVDQLCSALCSMLSGPKTLERL
RGAPEGFSRTDLHLAVVPVLTALISYHNYLDKTKQREMVYCLEQGLIHRC
ASQCVVALSICSVEMPDIIIKALPVLVVKLTHISATASMAVPLLEFLSTL
ARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIA
RPPKQGLNNSPPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASL
GSADENSVAQADDSLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEF
LLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGELQSGPESSSSPGV
HVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVGALDVPASQFL
GSATSPGPRTAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVR
RPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALY
KSLSVPAASTAKPPPLPRSNTVASFSSLYQSSCQGQLHRSVSWADSAVVM
EEGSPGEVPVLVEPPGLEDVEAALGMDRRTDAYSRSSSVSSQEEKSLHAE
ELVGRGIPIERVVSSEGGRPSVDLSFQPSQPLSKSSSSPELQTLQDILGD
PGDKADVGRLSPEVKARSQSGTLDGESAAWSASGEDSRGQPEGPLPSSSP
RSPSGLRPRGYTISDSAPSRRGKRVERDALKSRATASNAEKVPGINPSFV
FLQLYHSPFFGDESNKPILLPNESQSFERSVQLLDQIPSYDTHKIAVLYV
GEGQSNSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVC
GEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIVY
NDSGEDFKLGTIKGQFNFVHVIVTPLDYECNLVSLQCRKDMEGLVDTSVA
KIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRL
RQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSV
EDFTEFV

Кодований геном білок за функціями належить до активаторів гтфаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, альтернативний сплайсинг. Локалізований у цитоплазмі, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Xiao G.-H., Shoarinejad F., Jin F., Golemis E.A., Yeung R.S. (1997). The tuberous sclerosis 2 gene product, tuberin, functions as a Rab5 GTPase activating protein (GAP) in modulating endocytosis.. J. Biol. Chem. 272: 6097 — 6100.  PubMed DOI:10.1074/jbc.272.10.6097
  • Manning B.D., Tee A.R., Logsdon M.N., Blenis J., Cantley L.C. (2002). Identification of the tuberous sclerosis complex-2 tumor suppressor gene product tuberin as a target of the phosphoinositide 3-kinase/akt pathway.. Mol. Cell 10: 151 — 162.  PubMed DOI:10.1016/S1097-2765(02)00568-3
  • Inoki K., Zhu T., Guan K.L. (2003). TSC2 mediates cellular energy response to control cell growth and survival.. Cell 115: 577 — 590.  PubMed DOI:10.1016/S0092-8674(03)00929-2
  • Li Y., Inoki K., Guan K.-L. (2004). Biochemical and functional characterizations of small GTPase Rheb and TSC2 GAP activity.. Mol. Cell. Biol. 24: 7965 — 7975.  PubMed DOI:10.1128/MCB.24.18.7965-7975.2004
  • Roux P.P., Ballif B.A., Anjum R., Gygi S.P., Blenis J. (2004). Tumor-promoting phorbol esters and activated Ras inactivate the tuberous sclerosis tumor suppressor complex via p90 ribosomal S6 kinase.. Proc. Natl. Acad. Sci. U.S.A. 101: 13489 — 13494.  PubMed DOI:10.1073/pnas.0405659101

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]