ADA2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ADA2
Protein CECR1 PDB 3LGD.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ADA2, ADGF, IDGFL, PAN, SNEDS, CECR1, cat eye syndrome chromosome region, candidate 1, adenosine deaminase 2, VAIHS
Зовнішні ІД OMIM: 607575 HomoloGene: 81852 GeneCards: ADA2
Пов'язані генетичні захворювання
Sneddon syndrome[1]
Шаблон експресії
PBB GE CECR1 219505 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
XM_682627
RefSeq (білок)
XP_687719
Локус (UCSC) Хр. 22: 17.18 – 17.26 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ADA2 (англ. Adenosine deaminase 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 511 амінокислот, а молекулярна маса — 58 934[5].

Послідовність амінокислот
1020304050
MLVDGPSERPALCFLLLAVAMSFFGSALSIDETRAHLLLKEKMMRLGGRL
VLNTKEELANERLMTLKIAEMKEAMRTLIFPPSMHFFQAKHLIERSQVFN
ILRMMPKGAALHLHDIGIVTMDWLVRNVTYRPHCHICFTPRGIMQFRFAH
PTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHPEVIYTNQ
NVVWSKFETIFFTISGLIHYAPVFRDYVFRSMQEFYEDNVLYMEIRARLL
PVYELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAV
IAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVK
LPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWK
KDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKG
LSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKR
WDKFIADVATK

Кодований геном білок за функцією належить до гідролаз. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, з молекулою гепарину. Секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zavialov A.V., Engstroem A. (2005). Human ADA2 belongs to a new family of growth factors with adenosine deaminase activity.. Biochem. J. 391: 51 — 57.  PubMed DOI:10.1042/BJ20050683
  • Zavialov A.V., Yu X., Spillmann D., Lauvau G., Zavialov A.V. (2010). Structural basis for the growth factor activity of human adenosine deaminase ADA2.. J. Biol. Chem. 285: 12367 — 12377.  PubMed DOI:10.1074/jbc.M109.083527
  • Bras J., Guerreiro R., Santo G.C. (2014). Mutant ADA2 in vasculopathies.. N. Engl. J. Med. 371: 478 — 480.  PubMed DOI:10.1056/NEJMc1405506#SA3

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]