CHGA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CHGA
Ідентифікатори
Символи CHGAchromogranin-ASP-Iparathyroid secretory protein 1pituitary secretory protein ICgA
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE CHGA 204697 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

CHGA (англ. Chromogranin A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 457 амінокислот, а молекулярна маса — 50 688[2].

Послідовність амінокислот
1020304050
MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPM
PVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGF
EDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGAR
PQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAE
GDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGP
TVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHS
QQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAK
ELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSRE
DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
LQALRRG

Кодований геном білок за функціями належить до антибіотиків, антимікробних білків, фунгіцидів, фосфопротеїнів. Білок має сайт для зв'язування з іоном кальцію. Локалізований у мембрані, цитоплазматичних везикулах. Також секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wilson B.S., Phan S.H., Lloyd R.V. (1986). Chromogranin from normal human adrenal glands: purification by monoclonal antibody affinity chromatography and partial N-terminal amino acid sequence.. Regul. Pept. 13: 207 — 223.  PubMed DOI:10.1016/0167-0115(86)90040-6
  • Curry W.J., Shaw C., Johnston C.F., Thim L., Buchanan K.D. (1992). Isolation and primary structure of a novel chromogranin A-derived peptide, WE-14, from a human midgut carcinoid tumour.. FEBS Lett. 301: 319 — 321.  PubMed DOI:10.1016/0014-5793(92)80266-J
  • Giorgianni F., Beranova-Giorgianni S., Desiderio D.M. (2004). Identification and characterization of phosphorylated proteins in the human pituitary.. Proteomics 4: 587 — 598.  PubMed DOI:10.1002/pmic.200300584
  • Beranova-Giorgianni S., Zhao Y., Desiderio D.M., Giorgianni F. (2006). Phosphoproteomic analysis of the human pituitary.. Pituitary 9: 109 — 120.  PubMed DOI:10.1007/s11102-006-8916-x
  • Mahapatra N.R. (2008). Catestatin is a novel endogenous peptide that regulates cardiac function and blood pressure.. Cardiovasc. Res. 80: 330 — 338.  PubMed DOI:10.1093/cvr/cvn155

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:1929 (англ.). Процитовано 11 вересня 2017. 
  2. UniProt, P10645 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]