CYP2A13

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CYP2A13
Protein CYP2A13 PDB 1z10.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CYP2A13, CPAD, CYP2A, CYPIIA13, cytochrome P450 family 2 subfamily A member 13
Зовнішні ІД OMIM: 608055 MGI: 88597 HomoloGene: 85917 GeneCards: CYP2A13
Шаблон експресії
PBB GE CYP2A13 207718 x at fs.png

PBB GE CYP2A13 208327 at fs.png

PBB GE CYP2A13 211295 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000766
NM_007812
RefSeq (білок)
NP_000757
н/д
Локус (UCSC) Хр. 19: 41.09 – 41.1 Mb Хр. 7: 26.84 – 26.84 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CYP2A13 (англ. Cytochrome P450 family 2 subfamily A member 13) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 494 амінокислот, а молекулярна маса — 56 688[4].

Послідовність амінокислот
1020304050
MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLN
TEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSG
RGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQ
EEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLS
LLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAK
KVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFF
AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMP
YTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLR
DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
LFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом. Локалізований у мембрані, ендоплазматичному ретикулумі, мікросомах.

Література[ред. | ред. код]

  • DeVore N.M., Smith B.D., Urban M.J., Scott E.E. (2008). Key residues controlling phenacetin metabolism by human cytochrome P450 2A enzymes.. Drug Metab. Dispos. 36: 2582 — 2590.  PubMed DOI:10.1124/dmd.108.023770
  • Sansen S., Hsu M.H., Stout C.D., Johnson E.F. (2007). Structural insight into the altered substrate specificity of human cytochrome P450 2A6 mutants.. Arch. Biochem. Biophys. 464: 197 — 206.  PubMed DOI:10.1016/j.abb.2007.04.028

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2608 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q16696 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]