DHCR7

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DHCR7
Ідентифікатори
Символи DHCR7, SLOS, 7-dehydrocholesterol reductase
Зовнішні ІД OMIM: 602858 MGI: 1298378 HomoloGene: 1042 GeneCards: DHCR7
шифр КФ 1.3.1.21
Шаблон експресії
PBB GE DHCR7 201791 s at fs.png

PBB GE DHCR7 201790 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001163817
NM_001360
NM_007856
RefSeq (білок)
NP_001157289
NP_001351
NP_031882
Локус (UCSC) Хр. 11: 71.43 – 71.45 Mb Хр. 7: 143.82 – 143.85 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DHCR7 (англ. 7-dehydrocholesterol reductase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 475 амінокислот, а молекулярна маса — 54 489[4].

Послідовність амінокислот
1020304050
MAAKSQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFA
PFIVYYFIMACDQYSCALTGPVVDIVTGHARLSDIWAKTPPITRKAAQLY
TLWVTFQVLLYTSLPDFCHKFLPGYVGGIQEGAVTPAGVVNKYQINGLQA
WLLTHLLWFANAHLLSWFSPTIIFDNWIPLLWCANILGYAVSTFAMVKGY
FFPTSARDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFNGRPGIVAWTL
INLSFAAKQRELHSHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYI
FRVANHQKDLFRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFW
GVARHFNYVGDLMGSLAYCLACGGGHLLPYFYIIYMAILLTHRCLRDEHR
CASKYGRDWERYTAAVPYRLLPGIF

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як метаболізм ліпідів, метаболізм холестеролу, метаболізм стероїдів, метаболізм стеролів, біосинтез ліпідів, біосинтез холестеролу, біосинтез стероїдів, біосинтез стеролів. Білок має сайт для зв'язування з НАДФ. Локалізований у мембрані, ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • Moebius F.F., Fitzky B.U., Lee J.N., Paik Y.K., Glossmann H. (1998). Molecular cloning and expression of the human delta7-sterol reductase.. Proc. Natl. Acad. Sci. U.S.A. 95: 1899 — 1902.  PubMed DOI:10.1073/pnas.95.4.1899
  • Holmer L., Pezhman A., Worman H.J. (1998). The human lamin B receptor/sterol reductase multigene family.. Genomics 54: 469 — 476.  PubMed DOI:10.1006/geno.1998.5615
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2860 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q9UBM7 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]