ERCC1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ERCC1
Protein ERCC1 PDB 1z00.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ERCC1, COFS4, RAD10, UV20, excision repair cross-complementation group 1, ERCC excision repair 1, endonuclease non-catalytic subunit
Зовнішні ІД OMIM: 126380 MGI: 95412 HomoloGene: 1501 GeneCards: ERCC1
Шаблон експресії
PBB GE ERCC1 203720 s at fs.png

PBB GE ERCC1 203719 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001166049
NM_001983
NM_202001
NM_001127324
NM_007948
RefSeq (білок)
NP_001120796
NP_031974
Локус (UCSC) Хр. 19: 45.41 – 45.48 Mb Хр. 7: 19.34 – 19.36 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ERCC1 (англ. ERCC excision repair 1, endonuclease non-catalytic subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 297 амінокислот, а молекулярна маса — 32 562[4].

Послідовність амінокислот
1020304050
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVD
TSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNS
IIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHP
DYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAW
SPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDS
QTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP

Кодований геном білок за функціями належить до гідролаз, нуклеаз, ендонуклеаз. Задіяний у таких біологічних процесах, як пошкодження ДНК, репарація ДНК, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tsodikov O.V., Enzlin J.H., Scharer O.D., Ellenberger T. (2005). Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.. Proc. Natl. Acad. Sci. U.S.A. 102: 11236 — 11241.  PubMed DOI:10.1073/pnas.0504341102
  • Hoeijmakers J.H.J., van Duin M., Westerveld A., Yasui A., Bootsma D. (1986). Identification of DNA repair genes in the human genome.. Cold Spring Harb. Symp. Quant. Biol. 51: 91 — 101.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3433 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P07992 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]