IL31RA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IL31RA
Ідентифікатори
Символи IL31RA, CRL, CRL3, GLM-R, GLMR, GPL, IL-31RA, PLCA2, PRO21384, hGLM-R, interleukin 31 receptor A
Зовнішні ІД OMIM: 609510 MGI: 2180511 HomoloGene: 51395 GeneCards: IL31RA
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_139299
RefSeq (білок)
NP_647460
Локус (UCSC) Хр. 5: 55.85 – 55.92 Mb Хр. 13: 112.52 – 112.59 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IL31RA (англ. Interleukin 31 receptor A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 732 амінокислот, а молекулярна маса — 82 954[4].

Послідовність амінокислот
1020304050
MMWTWALWMLPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKETSY
TQYTVKRTYAFGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEA
ENGDGVIKSHMTYWRLENIAKTEPPKIFRVKPVLGIKRMIQIEWIKPELA
PVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIA
LRCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLL
WKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWV
SMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSAL
DVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYP
MLHDKVGEPYSIQAYAKEGVPSEGPETKVENIGVKTVTITWKEIPKSERK
GIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTSYIVQVMASTSA
GGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLT
HLCWPTVPNPAESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPS
DKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPL
GKSFEELPVSPEIPPRKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLC
EEGAPNPYLKNSVTAREFLVSEKLPEHTKGEV

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах, як імунітет, альтернативний сплайсинг, поліморфізм. Локалізований у клітинній мембрані, мембрані, клітинних контактах, клітинних відростках, синапсах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504
  • Kasraie S., Niebuhr M., Baumert K., Werfel T. (2011). Functional effects of interleukin 31 in human primary keratinocytes.. Allergy 66: 845 — 852.  PubMed DOI:10.1111/j.1398-9995.2011.02545.x

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18969 (англ.). Процитовано 5 вересня 2017. 
  4. UniProt, Q8NI17 (англ.). Процитовано 5 вересня 2017. 

Див. також[ред. | ред. код]