NTNG1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NTNG1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NTNG1, Lmnt1, netrin G1
Зовнішні ІД OMIM: 608818 MGI: 1934028 HomoloGene: 8949 GeneCards: NTNG1
Пов'язані генетичні захворювання
Анорексія[1]
Шаблон експресії
PBB GE NTNG1 206713 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
NP_001106697
NP_001106699
NP_001299617
NP_001317594
NP_055732
NP_001156820
NP_001156821
NP_001156822
NP_109624
NP_597995
Локус (UCSC) Хр. 1: 107.14 – 107.48 Mb Хр. 3: 109.78 – 110.14 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NTNG1 (англ. Netrin G1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 539 амінокислот, а молекулярна маса — 60 541[5].

Послідовність амінокислот
1020304050
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMAC
QPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELA
HPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVI
TFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHT
VLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTT
KKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGT
ANTCIPSISSIGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCR
LGYFRNASAQLDDENVCIECYCNPLGSIHDRCNGSGFCECKTGTTGPKCD
ECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKL
RCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах як диференціація, нейрогенез. Локалізований у клітинній мембрані, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504
  • Lin J.C., Ho W.-H., Gurney A.L., Rosenthal A. (2003). The netrin-G1 ligand NGL-1 promotes the outgrowth of thalamocortical axons.. Nat. Neurosci. 6: 1270 — 1276.  PubMed DOI:10.1038/nn1148

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]