PTPRF

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PTPRF
Protein PTPRF PDB 1lar.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PTPRF, LAR, BNAH2, protein tyrosine phosphatase, receptor type F
Зовнішні ІД MGI: 102695 HomoloGene: 20623 GeneCards: PTPRF
Пов'язані генетичні захворювання
Аміотрофічний бічний склероз[1]
Шаблон експресії
PBB GE PTPRF 200636 s at fs.png

PBB GE PTPRF 200635 s at fs.png

PBB GE PTPRF 200637 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_011213
RefSeq (білок)
NP_035343
Локус (UCSC) Хр. 1: 43.53 – 43.62 Mb Хр. 4: 118.21 – 118.29 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PTPRF (англ. Protein tyrosine phosphatase, receptor type F) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 1 907 амінокислот, а молекулярна маса — 212 879[5].

Послідовність амінокислот
1020304050
MAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVA
SFVCQATGEPKPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQR
DEAIYECTATNSLGEINTSAKLSVLEEEQLPPGFPSIDMGPQLKVVEKAR
TATMLCAAGGNPDPEISWFKDFLPVDPATSNGRIKQLRSGALQIESSEES
DQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMPGGSVN
LTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVTYY
GIQYRAAGTEGPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPP
SEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVY
YTPDSRRPPNAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPS
PTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERIIMYELVYWAA
EDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEAR
TAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVD
GEDRGRHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVL
VRTDEDVPSGPPRKVEVEPLNSTAVHVYWKLPVPSKQHGQIRGYQVTYVR
LENGEPRGLPIIQDVMLAEAQWRPEESEDYETTISGLTPETTYSVTVAAY
TTKGDGARSKPKIVTTTGAVPGRPTMMISTTAMNTALLQWHPPKELPGEL
LGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGL
GEEFEKEIRTPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIIS
YTVVFRDINSQQELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLS
PSIQSRTMPVEQVFAKNFRVAAAMKTSVLLSWEVPDSYKSAVPFKILYNG
QSVEVDGHSMRKLIADLQPNTEYSFVLMNRGSSAGGLQHLVSIRTAPDLL
PHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPIDRVGGSMLTPR
WSTPEELELDELLEAIEQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTL
GDKKNYRGFYNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQV
TPAQQQEEPEMLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSI
GLKDSLLAHSSDPVEMRRLNYQTPGMRDHPPIPITDLADNIERLKANDGL
KFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGV
PGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMT
RLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGS
SEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSA
GVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFI
HEALLEAATCGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLASSK
AHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFL
DGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCH
QYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQF
TDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFI
TLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLG
SFDHYAT

Кодований геном білок за функціями належить до гідролаз, рецепторів, протеїн-фосфатаз, фосфопротеїнів. Задіяний у такому біологічному процесі як клітинна адгезія. Білок має сайт для зв'язування з з молекулою гепарину. Локалізований у мембрані.

Література[ред. | ред. код]

  • Streuli M., Krueger N.X., Hall L.R., Schlossman S.F., Saito H. (1988). A new member of the immunoglobulin superfamily that has a cytoplasmic region homologous to the leukocyte common antigen.. J. Exp. Med. 168: 1523 — 1530.  PubMed DOI:10.1084/jem.168.5.1523
  • Homma K., Kikuno R.F., Nagase T., Ohara O., Nishikawa K. (2004). Alternative splice variants encoding unstable protein domains exist in the human brain.. J. Mol. Biol. 343: 1207 — 1220.  PubMed DOI:10.1016/j.jmb.2004.09.028
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Streuli M., Krueger N.X., Tsai A.Y.M., Saito H. (1989). A family of receptor-linked protein tyrosine phosphatases in humans and Drosophila.. Proc. Natl. Acad. Sci. U.S.A. 86: 8698 — 8702.  PubMed DOI:10.1073/pnas.86.22.8698
  • Ahmad F., Goldstein B.J. (1997). Functional association between the insulin receptor and the transmembrane protein-tyrosine phosphatase LAR in intact cells.. J. Biol. Chem. 272: 448 — 457.  PubMed DOI:10.1074/jbc.272.11.7519
  • Serra-Pages C., Medley Q.G., Tang M., Hart A., Streuli M. (1998). Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins.. J. Biol. Chem. 273: 15611 — 15620.  PubMed DOI:10.1074/jbc.273.25.15611

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]