RANBP2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RANBP2
Protein RANBP2 PDB 1rrp.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи RANBP2, ADANE, ANE1, IIAE3, NUP358, TRP1, TRP2, RAN binding protein 2
Зовнішні ІД OMIM: 601181 HomoloGene: 136803 GeneCards: RANBP2
Шаблон експресії
PBB GE RANBP2 201711 x at fs.png

PBB GE RANBP2 201712 s at fs.png

PBB GE RANBP2 201713 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006267
н/д
RefSeq (білок)
NP_006258
н/д
Локус (UCSC) Хр. 2: 108.72 – 108.79 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

RANBP2 (англ. RAN binding protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [2] Довжина поліпептидного ланцюга білка становить 3 224 амінокислот, а молекулярна маса — 358 199[3].

Послідовність амінокислот
1020304050
MRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYIC
TYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKI
AELLCKNDVTDGRAKYWLERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKL
FDLIQSELYVRPDDVHVNIRLVEVYRSTKRLKDAVAHCHEAERNIALRSS
LEWNSCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYANLMLLTLSTR
DVQESRELLQSFDSALQSVKSLGGNDELSATFLEMKGHFYMHAGSLLLKM
GQHSSNVQWRALSELAALCYLIAFQVPRPKIKLIKGEAGQNLLEMMACDR
LSQSGHMLLNLSRGKQDFLKEIVETFANKSGQSALYDALFSSQSPKDTSF
LGSDDIGNIDVREPELEDLTRYDVGAIRAHNGSLQHLTWLGLQWNSLPAL
PGIRKWLKQLFHHLPHETSRLETNAPESICILDLEVFLLGVVYTSHLQLK
EKCNSHHSSYQPLCLPLPVCKQLCTERQKSWWDAVCTLIHRKAVPGNVAK
LRLLVQHEINTLRAQEKHGLQPALLVHWAECLQKTGSGLNSFYDQREYIG
RSVHYWKKVLPLLKIIKKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDA
HITFAILDAVNGNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDALS
PEEQEECKNYLRKTRDYLIKIIDDSDSNLSVVKKLPVPLESVKEMLNSVM
QELEDYSEGGPLYKNGSLRNADSEIKHSTPSPTRYSLSPSKSYKYSPKTP
PRWAEDQNSLLKMICQQVEAIKKEMQELKLNSSNSASPHRWPTENYGPDS
VPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
PVYGMNRLPPQQHIYAYPQQMHTPPVQSSSACMFSQEMYGPPALRFESPA
TGILSPRGDDYFNYNVQQTSTNPPLPEPGYFTKPPIAAHASRSAESKTIE
FGKTNFVQPMPGEGLRPSLPTQAHTTQPTPFKFNSNFKSNDGDFTFSSPQ
VVTQPPPAAYSNSESLLGLLTSDKPLQGDGYSGAKPIPGGQTIGPRNTFN
FGSKNVSGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKSVFGTPTLETA
NKNHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAK
LFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISP
DMKLTPNAGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEE
AQSILKAPGTNVAMASNQAVRIVKEPTSHDNKDICKSDAGNLNFEFQVAK
KEGSWWHCNSCSLKNASTAKKCVSCQNLNPSNKELVGPPLAETVFTPKTS
PENVQDRFALVTPKKEGHWDCSICLVRNEPTVSRCIACQNTKSANKSGSS
FVHQASFKFGQGDLPKPINSDFRSVFSTKEGQWDCSACLVQNEGSSTKCA
ACQNPRKQSLPATSIPTPASFKFGTSETSKTLKSGFEDMFAKKEGQWDCS
SCLVRNEANATRCVACQNPDKPSPSTSVPAPASFKFGTSETSKAPKSGFE
GMFTKKEGQWDCSVCLVRNEASATKCIACQNPGKQNQTTSAVSTPASSET
SKAPKSGFEGMFTKKEGQWDCSVCLVRNEASATKCIACQNPGKQNQTTSA
VSTPASSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNEASATKCIACQCP
SKQNQTTAISTPASSEISKAPKSGFEGMFIRKGQWDCSVCCVQNESSSLK
CVACDASKPTHKPIAEAPSAFTLGSEMKLHDSSGSQVGTGFKSNFSEKAS
KFGNTEQGFKFGHVDQENSPSFMFQGSSNTEFKSTKEGFSIPVSADGFKF
GISEPGNQEKKSEKPLENGTGFQAQDISGQKNGRGVIFGQTSSTFTFADL
AKSTSGEGFQFGKKDPNFKGFSGAGEKLFSSQYGKMANKANTSGDFEKDD
DAYKTEDSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQRVKLFRFDAEVS
QWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSG
SDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIP
LQTPHKLVDTGRAAKLIQRAEEMKSGLKDFKTFLTNDQTKVTEEENKGSG
TGAAGASDTTIKPNPENTGPTLEWDNYDLREDALDDSVSSSSVHASPLAS
SPVRKNLFRFGESTTGFNFSFKSALSPSKSPAKLNQSGTSVGTDEESDVT
QEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAKLYRYDKDVGQWK
ERGIGDIKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMTLQNMKGTER
VWLWTACDFADGERKVEHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLIT
PHVSRSSTPRESPCGKIAVAVLEETTRERTDVIQGDDVADATSEVEVSST
SETTPKAVVSPPKFVFGSESVKSIFSSEKSKPFAFGNSSATGSLFGFSFN
APLKSNNSETSSVAQSGSESKVEPKKCELSKNSDIEQSSDSKVKNLFASF
PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATK
LKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLE
ENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNG
EDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSIT
KSISSPSVSSETMDKPVDLSTRKEIDTDSTSQGESKIVSFGFGSSTGLSF
ADLASSNSGDFAFGSKDKNFQWANTGAAVFGTQSVGTQSAGKVGEDEDGS
DEEVVHNEDIHFEPIVSLPEVEVKSGEEDEEILFKERAKLYRWDRDVSQW
KERGVGDIKILWHTMKNYYRILMRRDQVFKVCANHVITKTMELKPLNVSN
NALVWTASDYADGEAKVEQLAVRFKTKEVADCFKKTFEECQQNLMKLQKG
HVSLAAELSKETNPVVFFDVCADGEPLGRITMELFSNIVPRTAENFRALC
TGEKGFGFKNSIFHRVIPDFVCQGGDITKHDGTGGQSIYGDKFEDENFDV
KHTGPGLLSMANQGQNTNNSQFVITLKKAEHLDFKHVVFGFVKDGMDTVK
KIESFGSPKGSVCRRITITECGQI

Кодований геном білок за функціями належить до лігаз, фосфопротеїнів. Задіяний у таких біологічних процесах як транспорт, транспорт білків, убіквітинування білків, транспорт мРНК, транслокація, поліморфізм, ацетиляція. Білок має сайт для зв'язування з іонами металів, іоном цинку, РНК. Локалізований у ядрі, мембрані, комплексі ядерної пори.

Література[ред. | ред. код]

  • Wu J., Matunis M.J., Kraemer D., Blobel G., Coutavas E. (1995). Nup358, a cytoplasmically exposed nucleoporin with peptide repeats, Ran-GTP binding sites, zinc fingers, a cyclophilin A homologous domain, and a leucine-rich region.. J. Biol. Chem. 270: 14209 — 14213.  PubMed DOI:10.1074/jbc.270.23.14209
  • Beddow A.L., Richards S.A., Orem N.R., Macara I.G. (1995). The Ran/TC4 GTPase-binding domain: identification by expression cloning and characterization of a conserved sequence motif.. Proc. Natl. Acad. Sci. U.S.A. 92: 3328 — 3332.  PubMed DOI:10.1073/pnas.92.8.3328
  • Pichler A., Gast A., Seeler J.S., Dejean A., Melchior F. (2002). The nucleoporin RanBP2 has SUMO1 E3 ligase activity.. Cell 108: 109 — 120.  PubMed DOI:10.1016/S0092-8674(01)00633-X
  • Frosst P., Guan T., Subauste C., Hahn K., Gerace L. (2002). Tpr is localized within the nuclear basket of the pore complex and has a role in nuclear protein export.. J. Cell Biol. 156: 617 — 630.  PubMed DOI:10.1083/jcb.200106046
  • Pichler A., Knipscheer P., Saitoh H., Sixma T.K., Melchior F. (2004). The RanBP2 SUMO E3 ligase is neither HECT- nor RING-type.. Nat. Struct. Mol. Biol. 11: 984 — 991.  PubMed DOI:10.1038/nsmb834
  • Song J., Durrin L.K., Wilkinson T.A., Krontiris T.G., Chen Y. (2004). Identification of a SUMO-binding motif that recognizes SUMO-modified proteins.. Proc. Natl. Acad. Sci. U.S.A. 101: 14373 — 14378.  PubMed DOI:10.1073/pnas.0403498101

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:9848 (англ.). Процитовано 28 серпня 2017. 
  3. UniProt, P49792 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]