RBBP8

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RBBP8
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RBBP8, COM1, CTIP, JWDS, RIM, SAE2, SCKL2, retinoblastoma binding protein 8, RB binding protein 8, endonuclease
Зовнішні ІД OMIM: 604124 MGI: 2442995 HomoloGene: 28546 GeneCards: RBBP8
Пов'язані генетичні захворювання
Seckel syndrome 2, Jawad syndrome[1]
Шаблон експресії
PBB GE RBBP8 203344 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002894
NM_203291
NM_203292
NM_001081223
NM_001252495
NM_175458
RefSeq (білок)
NP_002885
NP_976036
NP_976037
NP_002885.1
NP_976036.1
NP_001074692
NP_001239424
Локус (UCSC) Хр. 18: 22.8 – 23.03 Mb Хр. 18: 11.63 – 11.75 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RBBP8 (англ. RB binding protein 8, endonuclease) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 897 амінокислот, а молекулярна маса — 101 942[5].

Послідовність амінокислот
1020304050
MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERI
LDAQRLEEFFTKNQQLREQQKVLHETIKVLEDRLRAGLCDRCAVTEEHMR
KKQQEFENIRQQNLKLITELMNERNTLQEENKKLSEQLQQKIENDQQHQA
AELECEEDVIPDSPITAFSFSGVNRLRRKENPHVRYIEQTHTKLEHSVCA
NEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHGTSSYTPDKSS
FNLATVVAETLGLGVQEESETQGPMSPLGDELYHCLEGNHKKQPFEESTR
NTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSL
LQPGKKKHLKTLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQ
SSNKQILINKNISESLGEQNRTEYGKDSNTDKHLEPLKSLGGRTSKRKKT
EEESEHEVSCPQASFDKENAFPFPMDNQFSMNGDCVMDKPLDLSDRFSAI
QRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSP
GEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVL
DDIKSAGSHEPIKIQTRSDHGGCELASVLQLNPCRTGKIKSLQNNQDVSF
ENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVL
LKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEEYESCLADSFSQAADE
EEELSTATKKLHTHGDKQDKVKQKAFVEPYFKGDERETSLQNFPHIEVVR
KKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRFRYIPPNTPEN
FWEVGFPSTQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT

Кодований геном білок за функціями належить до гідролаз, нуклеаз, ендонуклеаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, поділ клітини, пошкодження ДНК, репарація ДНК, мітоз, мейоз, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.

Література[ред. | ред. код]

  • Fusco C., Reymond A., Zervos A.S. (1998). Molecular cloning and characterization of a novel retinoblastoma-binding protein.. Genomics 51: 351 — 358.  PubMed DOI:10.1006/geno.1998.5368
  • Schaeper U., Subramanian T., Lim L., Boyd J.M., Chinnadurai G. (1998). Interaction between a cellular protein that binds to the C-terminal region of adenovirus E1A (CtBP) and a novel cellular protein is disrupted by E1A through a conserved PLDLS motif.. J. Biol. Chem. 273: 8549 — 8552.  PubMed DOI:10.1074/jbc.273.15.8549
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yu X., Baer R. (2000). Nuclear localization and cell cycle-specific expression of CtIP, a protein that associates with the BRCA1 tumor suppressor.. J. Biol. Chem. 275: 18541 — 18549.  PubMed DOI:10.1074/jbc.M909494199
  • Yu X., Chen J. (2004). DNA damage-induced cell cycle checkpoint control requires CtIP, a phosphorylation-dependent binding partner of BRCA1 C-terminal domains.. Mol. Cell. Biol. 24: 9478 — 9486.  PubMed DOI:10.1128/MCB.24.21.9478-9486.2004
  • Yu X., Fu S., Lai M., Baer R., Chen J. (2006). BRCA1 ubiquitinates its phosphorylation-dependent binding partner CtIP.. Genes Dev. 20: 1721 — 1726.  PubMed DOI:10.1101/gad.1431006

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]