RRM2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RRM2
PDB 1h0o EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RRM2, R2, RR2, RR2M, ribonucleotide reductase regulatory subunit M2
Зовнішні ІД OMIM: 180390 MGI: 98181 HomoloGene: 20277 GeneCards: RRM2
Реагує на сполуку
clofarabine, Гемцитабін, Гідроксикарбамід[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001165931
NM_001034
NM_009104
RefSeq (білок)
NP_001025
NP_001159403
NP_033130
Локус (UCSC) Хр. 2: 10.12 – 10.21 Mb Хр. 12: 24.71 – 24.71 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RRM2 (англ. Ribonucleotide reductase regulatory subunit M2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 389 амінокислот, а молекулярна маса — 44 878[5].

Послідовність амінокислот
1020304050
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARR
IFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEAS
FWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFS
QEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETM
PCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRG
LMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Задіяний у таких біологічних процесах як реплікація ДНК, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном заліза. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • Pavloff N., Rivard D., Masson S., Shen S.-H., Mes-Masson A.-M. (1992). Sequence analysis of the large and small subunits of human ribonucleotide reductase.. DNA Seq. 2: 227 — 234.  PubMed DOI:10.3109/10425179209020807
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Zhou B., Yen Y. (2001). Characterization of the human ribonucleotide reductase M2 subunit gene; genomic structure and promoter analyses.. Cytogenet. Cell Genet. 95: 52 — 59.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]