SLC46A1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SLC46A1
Ідентифікатори
Символи SLC46A1, G21, HCP1, PCFT, solute carrier family 46 member 1
Зовнішні ІД MGI: 1098733 HomoloGene: 41693 GeneCards: SLC46A1
Реагує на сполуку
Індометацин, Метотрексат[1]
Шаблон експресії
PBB GE PCFT gnf1h08403 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001242366
NM_080669
NM_026740
RefSeq (білок)
NP_001229295
NP_542400
NP_081016
Локус (UCSC) Хр. 17: 28.39 – 28.41 Mb Хр. 11: 78.47 – 78.47 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SLC46A1 (англ. Solute carrier family 46 member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 459 амінокислот, а молекулярна маса — 49 771[5].

Послідовність амінокислот
1020304050
MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR
FSADLGYNGTRQRGGCSNRSADPTMQEVETLTSHWTLYMNVGGFLVGLFS
STLLGAWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQLHVGYFVLGRIL
CALLGDFGGLLAASFASVADVSSSRSRTFRMALLEASIGVAGMLASLLGG
HWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKSTRLFTFRHHRS
IVQLYVAPAPEKSRKHLALYSLAIFVVITVHFGAQDILTLYELSTPLCWD
SKLIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFA
FATITPLMFTGYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNS
LAMLTASGIFNSLYPATLNFMKGFPFLLGAGLLLIPAVLIGMLEKADPHL
EFQQFPQSP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, ацетилювання, альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Latunde-Dada G.O., Takeuchi K., Simpson R.J., McKie A.T. (2006). Haem carrier protein 1 (HCP1): expression and functional studies in cultured cells.. FEBS Lett. 580: 6865 — 6870.  PubMed DOI:10.1016/j.febslet.2006.11.048
  • Sharma S., Dimasi D., Broeer S., Kumar R., Della N.G. (2007). Heme carrier protein 1 (HCP1) expression and functional analysis in the retina and retinal pigment epithelium.. Exp. Cell Res. 313: 1251 — 1259.  PubMed DOI:10.1016/j.yexcr.2007.01.019
  • Duddempudi P.K., Nakashe P., Blanton M.P., Jansen M. (2013). The monomeric state of the proton-coupled folate transporter represents the functional unit in the plasma membrane.. FEBS J. 280: 2900 — 2915.  PubMed DOI:10.1111/febs.12293
  • Wilson M.R., Hou Z., Matherly L.H. (2014). Substituted cysteine accessibility reveals a novel transmembrane 2-3 reentrant loop and functional role for transmembrane domain 2 in the human proton-coupled folate transporter.. J. Biol. Chem. 289: 25287 — 25295.  PubMed DOI:10.1074/jbc.M114.578252

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]