UGT1A6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
UGT1A6
Ідентифікатори
Символи UGT1A6, GNT1, HLUGP, HLUGP1, UDPGT, UDPGT 1-6, UGT1, UGT1A6S, UGT1F, UDP glucuronosyltransferase family 1 member A6, UGT1.5, hUG-BR1, UGT1.3, UGT-1C, UGT1A, UGT1E, UGT-1A, UGT-1E, UGT1A3, UGT1A1, UGT1A5, UGT1-01, UGT1C, UGT1-05, UGT1-03, UGT1.1
Зовнішні ІД OMIM: 606431 MGI: 3580629 HomoloGene: 85959 GeneCards: UGT1A6
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_205862
NM_001072
NM_201410
RefSeq (білок)
NP_001063
NP_995584
NP_958812
Локус (UCSC) Хр. 2: 233.69 – 233.77 Mb Хр. 1: 88.1 – 88.22 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

UGT1A6 (англ. UDP glucuronosyltransferase family 1 member A6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 532 амінокислот, а молекулярна маса — 60 751[4].

Послідовність амінокислот
1020304050
MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLS
DRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFA
ERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESKFDALFTD
PALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFS
DHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRDVDIITLYQKV
SVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHG
IVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTIL
VKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNA
KRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRP
VEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLT
VAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Кодований геном білок за функціями належить до трансфераз, глікозилтрансфераз. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Локалізований у мембрані, ендоплазматичному ретикулумі, мікросомах.

Література[ред. | ред. код]

  • Harding D., Fournel-Gigleux S., Jackson M.R., Burchell B. (1988). Cloning and substrate specificity of a human phenol UDP-glucuronosyltransferase expressed in COS-7 cells.. Proc. Natl. Acad. Sci. U.S.A. 85: 8381 — 8385.  PubMed DOI:10.1073/pnas.85.22.8381
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Muenzel P.A., Lehmkoester T., Brueck M., Ritter J.K., Bock K.W. (1998). Aryl hydrocarbon receptor-inducible or constitutive expression of human UDP glucuronosyltransferase UGT1A6.. Arch. Biochem. Biophys. 350: 72 — 78.  PubMed DOI:10.1006/abbi.1997.0485
  • Bellemare J., Rouleau M., Girard H., Harvey M., Guillemette C. (2010). Alternatively spliced products of the UGT1A gene interact with the enzymatically active proteins to inhibit glucuronosyltransferase activity in vitro.. Drug Metab. Dispos. 38: 1785 — 1789.  PubMed DOI:10.1124/dmd.110.034835
  • Nagar S., Zalatoris J.J., Blanchard R.L. (2004). Human UGT1A6 pharmacogenetics: identification of a novel SNP, characterization of allele frequencies and functional analysis of recombinant allozymes in human liver tissue and in cultured cells.. Pharmacogenetics 14: 487 — 499.  PubMed DOI:10.1097/01.fpc.0000114771.78957.cb
  • Menard V., Girard H., Harvey M., Perusse L., Guillemette C. (2009). Analysis of inherited genetic variations at the UGT1 locus in the French-Canadian population.. Hum. Mutat. 30: 677 — 687.  PubMed DOI:10.1002/humu.20946

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:12538 (англ.). Процитовано 29 серпня 2017. 
  4. UniProt, P19224 (англ.). Процитовано 29 серпня 2017. 

Див. також[ред. | ред. код]