Фібрилін-1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Фібрилін-1
Protein FBN1 PDB 1apj.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FBN1, ACMICD, ECTOL1, FBN, GPHYSD2, MASS, MFS1, OCTD, SGS, SSKS, WMS, WMS2, MFLS, fibrillin 1
Зовнішні ІД OMIM: 134797 MGI: 95489 HomoloGene: 30958 GeneCards: FBN1
Пов'язані генетичні захворювання
рак молочної залози, stiff skin syndrome, Acromicric dysplasia, marfanoid–progeroid–lipodystrophy syndrome[1]
Шаблон експресії
PBB GE FBN1 202765 s at fs.png

PBB GE FBN1 202766 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000138
NM_007993
RefSeq (білок)
NP_000129
NP_032019
Локус (UCSC) Хр. 15: 48.41 – 48.65 Mb Хр. 2: 125.3 – 125.51 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Фібрилін-1 (англ. Fibrillin 1) – білок, який кодується геном FBN1, розташованим у людей на короткому плечі 15-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 2 871 амінокислот, а молекулярна маса — 312 237[5].

Послідовність амінокислот
1020304050
MRRGRLLEIALGFTVLLASYTSHGADANLEAGNVKETRASRAKRRGGGGH
DALKGPNVCGSRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMC
TCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDDHCLCQKGYIGTHCGQPVC
ESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVISNQMCQGQLS
GIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDEC
QAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGICE
GGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLP
QSITKMQCCCDAGRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPE
YPPPPLGPIPPVLPVPPGFPPGPQIPVPRPPVEYLYPSREPPRVLPVNVT
DYCQLVRYLCQNGRCIPTPGSCRCECNKGFQLDLRGECIDVDECEKNPCA
GGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRICNNGRCINTD
GSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKP
GFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGR
VCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCP
AQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENLRGTYKCIC
NSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKP
DLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDPTKTICIETIK
GTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGY
SRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRIC
LDIRLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRN
TPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLCTHGKCRNTIGS
FKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEG
YESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNI
SACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDE
CSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICD
GGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTK
GSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSC
SPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGF
TCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDEC
SLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISG
NCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACS
NEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPI
TVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVN
ECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYY
ADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGS
QRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYN
DKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDR
NECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDAC
GNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINT
VGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCIC
PPGYSLQNEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSG
RRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCP
TEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYR
CECPFGYILAGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGP
MMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDE
CEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPG
ICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQI
GSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG
ADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQ
APKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLC
VNTIGGFTCKCPPGFTQHHTSCIDNNECTSDINLCGSKGICQNTPGSFTC
ECQRGFSLDQTGSSCEDVDECEGNHRCQHGCQNIIGGYRCSCPQGYLQHY
QWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDIN
ECGSAQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVSGMGMGRGNPEPP
VSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEAN
VSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNE
DGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYD
KDYLSGELGDNLKMKIQVLLH

Цей білок за функцією належить до гормонів. Білок має сайт для зв'язування з іоном кальцію, з молекулою гепарину. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Corson G.M., Chalberg S.C., Dietz H.C., Charbonneau N.L., Sakai L.Y. (1993). Fibrillin binds calcium and is coded by cDNAs that reveal a multidomain structure and alternatively spliced exons at the 5' end.. Genomics 17: 476 — 484.  PubMed DOI:10.1006/geno.1993.1350
  • Maslen C.L., Corson G.M., Maddox B.K., Glanville R.W., Sakai L.Y. (1991). Partial sequence of a candidate gene for the Marfan syndrome.. Nature 352: 334 — 337.  PubMed DOI:10.1038/352334a0
  • Reinhardt D.P., Gambee J.E., Ono R.N., Baechinger H.P., Sakai L.Y. (2000). Initial steps in assembly of microfibrils. Formation of disulfide-cross-linked multimers containing fibrillin-1.. J. Biol. Chem. 275: 2205 — 2210.  PubMed DOI:10.1074/jbc.275.3.2205
  • Loennqvist L., Reinhardt D., Sakai L., Peltonen L. (1998). Evidence for furin-type activity-mediated C-terminal processing of profibrillin-1 and interference in the processing by certain mutations.. Hum. Mol. Genet. 7: 2039 — 2044.  PubMed DOI:10.1093/hmg/7.13.2039
  • Glesby M.J., Pyeritz R.E. (1989). Association of mitral valve prolapse and systemic abnormalities of connective tissue: a phenotypic continuum.. JAMA 262: 523 — 528.  PubMed DOI:10.1001/jama.1989.03430040095032

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]