ASF1A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ASF1A
Protein ASF1A PDB 1tey.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ASF1A, CGI-98, CIA, HSPC146, anti-silencing function 1A histone chaperone
Зовнішні ІД OMIM: 609189 MGI: 1913653 HomoloGene: 8528 GeneCards: ASF1A
Шаблон експресії
PBB GE ASF1A 203428 s at fs.png

PBB GE ASF1A 203427 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014034
NM_025541
RefSeq (білок)
NP_054753
NP_079817
Локус (UCSC) Хр. 6: 118.89 – 118.91 Mb Хр. 10: 53.6 – 53.61 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ASF1A (англ. Anti-silencing function 1A histone chaperone) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 204 амінокислот, а молекулярна маса — 22 969[4].

Послідовність амінокислот
1020304050
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT
YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH
INWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESH
MDCM

Кодований геном білок за функціями належить до шаперонів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Локалізований у ядрі.

Література[ред. | ред. код]

  • Munakata T., Adachi N., Yokoyama N., Kuzuhara T., Horikoshi M. (2000). A human homologue of yeast anti-silencing factor has histone chaperone activity.. Genes Cells 5: 221 — 233.  PubMed DOI:10.1046/j.1365-2443.2000.00319.x
  • Sillje H.H.W., Nigg E.A. (2001). Identification of human Asf1 chromatin assembly factors as substrates of Tousled-like kinases.. Curr. Biol. 11: 1068 — 1073.  PubMed DOI:10.1016/S0960-9822(01)00298-6
  • Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. (2000). Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.. Genome Res. 10: 703 — 713.  PubMed DOI:10.1101/gr.10.5.703
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chimura T., Kuzuhara T., Horikoshi M. (2002). Identification and characterization of CIA/ASF1 as an interactor of bromodomains associated with TFIID.. Proc. Natl. Acad. Sci. U.S.A. 99: 9334 — 9339.  PubMed DOI:10.1073/pnas.142627899
  • Umehara T., Horikoshi M. (2003). Transcription initiation factor IID-interactive histone chaperone CIA-II implicated in mammalian spermatogenesis.. J. Biol. Chem. 278: 35660 — 35667.  PubMed DOI:10.1074/jbc.M303549200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:20995 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q9Y294 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]