BCHE

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BCHE
Protein BCHE PDB 1p0i.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BCHE, CHE1, CHE2, E1, butyrylcholinesterase, BCHED
Зовнішні ІД OMIM: 177400 MGI: 894278 HomoloGene: 20065 GeneCards: BCHE
Пов'язані генетичні захворювання
серцево-судинні захворювання[1]
Реагує на сполуку
bambuterol, physostigmine, pyridostigmine, rivastigmine, tacrine[2]
Шаблон експресії
PBB GE BCHE 205433 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000055
NM_009738
RefSeq (білок)
NP_000046
NP_033868
Локус (UCSC) Хр. 3: 165.77 – 165.84 Mb Хр. 3: 73.64 – 73.71 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BCHE (англ. Butyrylcholinesterase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 602 амінокислот, а молекулярна маса — 68 418[6].

Послідовність амінокислот
1020304050
MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFG
GTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQS
FPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGT
SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
LALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAIL
QSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI
LLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVN
KDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFH
YTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFE
HRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDNYTKAEEILSRSIVKRWA
NFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFW
TSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV
GL

Кодований геном білок за функціями належить до гідролаз, серинових естераз, фосфопротеїнів. Задіяний у такому біологічному процесі як поліморфізм. Білок має сайт для зв'язування з сіаловими кислотами. Секретований назовні.

Література[ред. | ред. код]

  • Prody C.A., Zevin-Sonkin D., Gnatt A., Goldberg O., Soreq H. (1987). Isolation and characterization of full-length cDNA clones coding for cholinesterase from fetal human tissues.. Proc. Natl. Acad. Sci. U.S.A. 84: 3555 — 3559.  PubMed DOI:10.1073/pnas.84.11.3555
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. (2004). Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.. Proteomics 4: 454 — 465.  PubMed DOI:10.1002/pmic.200300556
  • Amitay M., Shurki A. (2009). The structure of G117H mutant of butyrylcholinesterase: nerve agents scavenger.. Proteins 77: 370 — 377.  PubMed DOI:10.1002/prot.22442
  • Nicolet Y., Lockridge O., Masson P., Fontecilla-Camps J.C., Nachon F. (2003). Crystal structure of human butyrylcholinesterase and of its complexes with substrate and products.. J. Biol. Chem. 278: 41141 — 41147.  PubMed DOI:10.1074/jbc.M210241200
  • Nachon F., Asojo O.A., Borgstahl G.E.O., Masson P., Lockridge O. (2005). Role of water in aging of human butyrylcholinesterase inhibited by echothiophate: the crystal structure suggests two alternative mechanisms of aging.. Biochemistry 44: 1154 — 1162.  PubMed DOI:10.1021/bi048238d

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]