BRCA2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BRCA2
PBB Protein BRCA2 image.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BRCA2, BRCC2, BROVCA2, FACD, FAD, FAD1, FANCD, FANCD1, GLM3, PNCA2, XRCC11, breast cancer 2, DNA repair associated, breast cancer 2, early onset, BRCA2 DNA repair associated, Genes
Зовнішні ІД OMIM: 600185 MGI: 109337 HomoloGene: 41 GeneCards: BRCA2
Пов'язані генетичні захворювання
BRCA2 hereditary breast and ovarian cancer syndrome, Fanconi anemia complementation group D1[1]
Шаблон експресії
PBB GE BRCA2 208368 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000059
NM_001081001
NM_009765
RefSeq (білок)
NP_000050
NP_001074470
NP_033895
Локус (UCSC) Хр. 13: 32.32 – 32.4 Mb Хр. 5: 150.52 – 150.57 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BRCA2 (англ. BRCA2, DNA repair associated) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 13-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 3 418 амінокислот, а молекулярна маса — 384 202[5].

Послідовність амінокислот
1020304050
MPIGSKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPAEES
EHKNNNYEPNLFKTPQRKPSYNQLASTPIIFKEQGLTLPLYQSPVKELDK
FKLDLGRNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLSESPVVLQCTH
VTPQRDKSVVCGSLFHTPKFVKGRQTPKHISESLGAEVDPDMSWSSSLAT
PPTLSSTVLIVRNEEASETVFPHDTTANVKSYFSNHDESLKKNDRFIASV
TDSENTNQREAASHGFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVV
DTSEEDSFSLCFSKCRTKNLQKVRTSKTRKKIFHEANADECEKSKNQVKE
KYSFVSEVEPNDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTL
SGLNGAQMEKIPLLHISSCDQNISEKDLLDTENKRKKDFLTSENSLPRIS
SLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISGTSPVASSFQG
IKKSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKE
DSLCPNLIDNGSWPATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSY
KGKKIPKDQKSELINCSAQFEANAFEAPLTFANADSGLLHSSVKRSCSQN
DSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKEKLQL
FITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQHSKVEYSD
TDFQSQKSLLYDHENASTLILTPTSKDVLSNLVMISRGKESYKMSDKLKG
NNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYMRVASPSRKVQ
FNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNN
LALGNTKELHETDLTCVNEPIFKNSTMVLYGDTGDKQATQVSIKKDLVYV
LAEENKNSVKQHIKMTLGQDLKSDISLNIDKIPEKNNDYMNKWAGLLGPI
SNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVNT
LALDNQKKLSKPQSINTVSAHLQSSVVVSDCKNSHITPQMLFSKQDFNSN
HNLTPSQKAEITELSTILEESGSQFEFTQFRKPSYILQKSTFEVPENQMT
ILKTTSEECRDADLHVIMNAPSIGQVDSSKQFEGTVEIKRKFAGLLKNDC
NKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIENISEE
TSAEVHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEM
TTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIH
KDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEACH
GNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKESFNKIVNFF
DQKPEELHNFSLNSELHSDIRKNKMDILSYEETDIVKHKILKESVPVGTG
NQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKE
QGTSEITSFSHQWAKTLKYREACKDLELACETIEITAAPKCKEMQNSLNN
DKNLVSIETVVPPKLLSDNLCRQTENLKTSKSIFLKVKVHENVEKETAKS
PATCYTNQSPYSVIENSALAFYTSCSRKTSVSQTSLLEAKKWLREGIFDG
QPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYLSNSSMSNSYS
YHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAY
PQTVNEDICVEELVTSSSPCKNKNAAIKLSISNSNNFEVGPPAFRIASGK
IVCVSHETIKKVKDIFTDSFSKVIKENNENKSKICQTKIMAGCYEALDDS
EDILHNSLDNDECSTHSHKVFADIQSEEILQHNQNMSGLEKVSKISPCDV
SLETSDICKCSIGKLHKSVSSANTCGIFSTASGKSVQVSDASLQNARQVF
SEIEDSTKQVFSKVLFKSNEHSDQLTREENTAIRTPEHLISQKGFSYNVV
NSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQ
NVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIK
VSPYLSQFQQDKQQLVLGTKVSLVENIHVLGKEQASPKNVKMEIGKTETF
SDVPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDDELTDSKLPSHAT
HSLFTCPENEEMVLSNSRIGKRRGEPLILVGEPSIKRNLLNEFDRIIENQ
EKSLKASKSTPDGTIKDRRLFMHHVSLEPITCVPFRTTKERQEIQNPNFT
APGQEFLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMRHLITTG
RPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKIN
DNEIHQFNKNNSNQAAAVTFTKCEEEPLDLITSLQNARDIQDMRIKKKQR
QRVFPQPGSLYLAKTSTLPRISLKAAVGGQVPSACSHKQLYTYGVSKHCI
KINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPSNDGKAGKEEF
YRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPE
RVLLQLKYRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANI
SETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQK
IILHGAELVGSPDACTPLEAPESLMLKISANSTRPARWYTKLGFFPDPRP
FPLPLSSLFSDGGNVGCVDVIIQRAYPIQWMEKTSSGLYIFRNEREEEKE
AAKYVEAQQKRLEALFTKIQEEFEEHEENTTKPYLPSRALTRQQVRALQD
GAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKKQAQIQLEIRK
AMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDSVILSIWRPSSDLYSLL
TEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVSDEILFQIYQ
PREPLHFSKFLDPDFQPSCSEVDLIGFVVSVVKKTGLAPFVYLSDECYNL
LAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFSVFSASP
KEGHFQETFNKMKNTVENIDILCNEAENKLMHILHANDPKWSTPTKDCTS
GPYTAQIIPGTGNKLLMSSPNCEIYYQSPLSLCMAKRKSVSTPVSAQMTS
KSCKGEKEIDDQKNCKKRRALDFLSRLPLPPPVSPICTFVSPAAQKAFQP
PRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESNSIADEELALINTQ
ALLSGSTGEKQFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQESSQAS
TEECEKNKQDTITTKKYI

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, пошкодження ДНК, репарація ДНК, рекомбінація ДНК. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • Wang X.Z., Andreassen P.R., D'Andrea A.D. (2004). Functional interaction of monoubiquitinated FANCD2 and BRCA2/FANCD1 in chromatin.. Mol. Cell. Biol. 24: 5850 — 5862.  PubMed DOI:10.1128/MCB.24.13.5850-5862.2004
  • Schoenfeld A.R., Apgar S., Dolios G., Wang R., Aaronson S.A. (2004). BRCA2 is ubiquitinated in vivo and interacts with USP11, a deubiquitinating enzyme that exhibits prosurvival function in the cellular response to DNA damage.. Mol. Cell. Biol. 24: 7444 — 7455.  PubMed DOI:10.1128/MCB.24.17.7444-7455.2004
  • Ohashi A., Zdzienicka M.Z., Chen J., Couch F.J. (2005). FANCD2 functions independently of BRCA2 and RAD51 associated homologous recombination in response to DNA damage.. J. Biol. Chem. 280: 14877 — 14883.  PubMed DOI:10.1074/jbc.M414669200
  • Silva F.P., Hamamoto R., Nakamura Y., Furukawa Y. (2005). WDRPUH, a novel WD-repeat-containing protein, is highly expressed in human hepatocellular carcinoma and involved in cell proliferation.. Neoplasia 7: 348 — 355.  PubMed DOI:10.1593/neo.04544
  • Sy S.M., Huen M.S., Chen J. (2009). PALB2 is an integral component of the BRCA complex required for homologous recombination repair.. Proc. Natl. Acad. Sci. U.S.A. 106: 7155 — 7160.  PubMed DOI:10.1073/pnas.0811159106
  • Liu J., Doty T., Gibson B., Heyer W.D. (2010). Human BRCA2 protein promotes RAD51 filament formation on RPA-covered single-stranded DNA.. Nat. Struct. Mol. Biol. 17: 1260 — 1262.  PubMed DOI:10.1038/nsmb.1904

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]