CD2BP2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CD2BP2
Protein CD2BP2 PDB 1gyf.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CD2BP2, FWP010, LIN1, PPP1R59, Snu40, U5-52K, CD2 (cytoplasmic tail) binding protein 2, CD2 cytoplasmic tail binding protein 2
Зовнішні ІД OMIM: 604470 MGI: 1917483 HomoloGene: 4455 GeneCards: CD2BP2
Шаблон експресії
PBB GE CD2BP2 202256 at fs.png

PBB GE CD2BP2 202257 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006110
NM_001243646
NM_001285905
NM_001285906
NM_001285907
NM_027353
NM_001357817
RefSeq (білок)
NP_001230575
NP_006101
NP_001230575.1
NP_006101.1
NP_001272834
NP_001272835
NP_001272836
NP_081629
NP_001344746
Локус (UCSC) Хр. 16: 30.35 – 30.36 Mb Хр. 7: 127.19 – 127.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CD2BP2 (англ. CD2 cytoplasmic tail binding protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 341 амінокислот, а молекулярна маса — 37 646[4].

Послідовність амінокислот
1020304050
MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSD
EEEDDDDGGSSKYDILASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGH
FDADGNYFLNRDAQIRDSWLDNIDWVKIRERPPGQRQASDSEEEDSLGQT
SMSAQALLEGLLELLLPRETVAGALRRLGARGGGKGRKGPGQPSSPQRLD
RLSGLADQMVARGNLGVYQETRERLAMRLKGLGCQTLGPHNPTPPPSLDM
FAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFT
SAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як процесинг мРНК, сплайсинг мРНК, ацетилювання. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Nishizawa K., Freund C., Li J., Wagner G., Reinherz E.L. (1998). Identification of a proline-binding motif regulating CD2-triggered T lymphocyte activation.. Proc. Natl. Acad. Sci. U.S.A. 95: 14897 — 14902.  PubMed DOI:10.1073/pnas.95.25.14897
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Liu S., Rauhut R., Vornlocher H.-P., Luehrmann R. (2006). The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP.. RNA 12: 1418 — 1430.  PubMed DOI:10.1261/rna.55406
  • Heinze M., Kofler M., Freund C. (2007). Investigating the functional role of CD2BP2 in T cells.. Int. Immunol. 19: 1313 — 1318.  PubMed DOI:10.1093/intimm/dxm100
  • Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. (2008). Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.. J. Proteome Res. 7: 5167 — 5176.  PubMed DOI:10.1021/pr800500r
  • Freund C., Dotsch V., Nishizawa K., Reinherz E.L., Wagner G. (1999). The GYF domain is a novel structural fold that is involved in lymphoid signaling through proline-rich sequences.. Nat. Struct. Biol. 6: 656 — 660.  PubMed DOI:10.1038/10712

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1656 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, O95400 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]