DYSF

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DYSF
4ihb pdb.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DYSF, FER1L1, LGMD2B, MMD1, dysferlin
Зовнішні ІД OMIM: 603009 MGI: 1349385 HomoloGene: 20748 GeneCards: DYSF
Шаблон експресії
PBB GE DYSF 218660 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001077694
NM_021469
NM_001310152
RefSeq (білок)
NP_001071162
NP_001297081
NP_067444
Локус (UCSC) Хр. 2: 71.45 – 71.69 Mb Хр. 6: 84.01 – 84.21 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DYSF (англ. Dysferlin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 2 080 амінокислот, а молекулярна маса — 237 295[4].

Послідовність амінокислот
1020304050
MLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGF
EWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSAS
FNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDV
VADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGI
KRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTK
RTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGE
FRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEA
PLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMD
NVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPA
MFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAV
KPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGV
AYRGRLLLSLETKLVEHSEQKVEDLPADDILRVEKYLRRRKYSLFAAFYS
ATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYL
PWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQC
STEDVDSLVAQLTDELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLSQ
ITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQG
DKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPMEKVPGARMPV
QIRVKLWFGLSVDEKEFNQFAEGKLSVFAETYENETKLALVGNWGTTGLT
YPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFV
EEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWS
TDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYTHRRRRWVRLRRRDL
SQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEP
LEKTGPAAVFALEGALGGVMDDKSEDSMSVSTLSFGVNRPTISCIFDYGN
RYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWD
QTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE
RMPRLAWFPLTRGSQPSGELLASFELIQREKPAIHHIPGFEVQETSRILD
ESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLA
NISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPP
ITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESPSPQGGPDDVSLL
SPGEDVLIDIDDKEPLIPIQEEEFIDWWSKFFASIGEREKCGSYLEKDFD
TLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFK
IYPLPEDPAIPMPPRQFHQLAAQGPQECLVRIYIVRAFGLQPKDPNGKCD
PYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDY
DLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQ
LLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERL
ALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPP
FNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEH
KQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTES
KIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDA
FHPEWFVSLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEER
PAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRWAIILF
IILFILLLFLAIFIYAFPNYAAMKLVKPFS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном кальцію. Локалізований у клітинній мембрані, мембрані, цитоплазматичних везикулах.

Література[ред. | ред. код]

  • Pramono Z.A.D., Lai P.S., Tan C.L., Takeda S., Yee W.C. (2006). Identification and characterization of a novel human dysferlin transcript: dysferlin_v1.. Hum. Genet. 120: 410 — 419.  PubMed DOI:10.1007/s00439-006-0230-1
  • Davis D.B., Doherty K.R., Delmonte A.J., McNally E.M. (2002). Calcium-sensitive phospholipid binding properties of normal and mutant ferlin C2 domains.. J. Biol. Chem. 277: 22883 — 22888.  PubMed DOI:10.1074/jbc.M201858200
  • Abdullah N., Padmanarayana M., Marty N.J., Johnson C.P. (2014). Quantitation of the calcium and membrane binding properties of the c2 domains of dysferlin.. Biophys. J. 106: 382 — 389.  PubMed DOI:10.1016/j.bpj.2013.11.4492
  • Sula A., Cole A.R., Yeats C., Orengo C., Keep N.H. (2014). Crystal structures of the human Dysferlin inner DysF domain.. BMC Struct. Biol. 14: 3 — 3.  PubMed DOI:10.1186/1472-6807-14-3
  • Kawabe K., Goto K., Nishino I., Angelini C., Hayashi Y.K. (2004). Dysferlin mutation analysis in a group of Italian patients with limb-girdle muscular dystrophy and Miyoshi myopathy.. Eur. J. Neurol. 11: 657 — 661.  PubMed DOI:10.1111/j.1468-1331.2004.00755.x
  • Oh S.-H., Kim T.-S., Choi Y.-C. (2004). Identification of a dysferlin gene mutation in a Korean case with Miyoshi myopathy.. Yonsei Med. J. 45: 927 — 930.  PubMed DOI:10.3349/ymj.2004.45.5.927

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3097 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, O75923 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]