mTOR

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MTOR
Ідентифікатори
Символи MTORFKBP-rapamycin associated proteinFK506-binding protein 12-rapamycin complex-associated protein 1rapamycin associated protein FRAP2rapamycin target protein 1rapamycin and FKBP12 target 1FKBP12-rapamycin complex-associated proteinmechanistic target of rapamycin (serine/threonine kinase)serine/threonine-protein kinase mTORMechanistic target of rapamycinmammalian target of rapamycinFK506 binding protein 12-rapamycin associated protein 2FKBP12-rapamycin complex-associated protein 1
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE FRAP1 202288 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

MTOR (оригінальна назва англ. mammalian target of rapamycin, зараз офіційно англ. Mechanistic target of rapamycin kinase[1]) – білок, який кодується геном MTOR, розташованим у людини на короткому плечі 1-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 2 549 амінокислот, а молекулярна маса — 288 892[3].серин/треонінова протеїнкіназа ссавців родини фосфатидилінозитол 3-кінази, ключовий компонент сигнального шляху, який регулює базові аспекти поведінки клітини, такі як ріст (збільшення маси) і проліферація (поділ), в залежності від її енергетичного статусу, наявності/браку амінокислот, сигналів від факторів росту та інших зовнішніх і внутрішніх факторів. mTOR є мішенню рапаміцину — бактерійного токсину Streptomyces hygroscopicus, що використовується в клініці як імуносупресант і протираковий препарат. Дерегуляція шляху mTOR спостерігається у ряді захворювань людини, в тому числі нейродегенеративних, онкологічних, під час ожиріння та цукрового діабету другого типу[1].

Послідовність амінокислот
1020304050
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTM
ELREMSQEESTRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGN
ATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAGDTFTAEYVEFEVK
RALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWD
PKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFDETLA
KEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPS
PAKSTLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLA
AFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSVAVRSEFKV
YLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLARAMGPGIQQD
IKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHK
PLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQ
VVADVLSKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVAL
NDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIK
EQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLA
TIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVAS
TGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAV
SMVALMRIFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNV
IRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQS
TIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLLAAI
QLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVDRLTESLDFTD
YASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPV
ETGPMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSL
RSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDI
AEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYK
ELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWY
EKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVL
ALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELE
EVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDM
RTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAY
MKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARC
FLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSE
SEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNL
QDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPR
PLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCE
HSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEV
LEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPI
IRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQ
LFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALI
RDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLA
KLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLS
GKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYS
AGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQI
INRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW

Цей білок за функціями належить до серин/треонінових протеїнкіназ. Білок має сайт для зв'язування з АТФ. Локалізований у цитоплазмі, ядрі, мембрані, мітохондрії, ендоплазматичному ретикулумі, лізосомі, зовнішній мембрані мітохондрій, апараті гольджі, мікросомах.

Сигнальний шлях mTOR

mTOR входить до складу двох мультимерних білкових комплексів, що відрізняються активаторами, мішенями, та чутливістю до рапаміцину. mTOR комплекс 1 — TORC1, що містить білок «raptor», стимулює ріст клітин шляхом пришвидшення біогенезу рибосом і трансляції, сповільнення деградації білків і активації захоплення поживних речовин із середовища. TORC1 чутливий до рапаміцину. До складу TORC2 (mTOR комплекс 2) входить білок «rictor», цей комплекс регулює цитоскелет через родину ГТФаз Rho і допомагає активувати кіназу Akt[4].


Див. також[ред. | ред. код]

Література[ред. | ред. код]

  • Onyango P., Lubyova B., Gardellin P., Kurzbauer R., Weith A. (1998). Molecular cloning and expression analysis of five novel genes in chromosome 1p36.. Genomics 50: 187 — 198.  PubMed DOI:10.1006/geno.1997.5186
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chiu M.I., Katz H., Berlin V. (1994). RAPT1, a mammalian homolog of yeast Tor, interacts with the FKBP12/rapamycin complex.. Proc. Natl. Acad. Sci. U.S.A. 91: 12574 — 12578.  PubMed DOI:10.1073/pnas.91.26.12574
  • Park I.H., Bachmann R., Shirazi H., Chen J. (2002). Regulation of ribosomal S6 kinase 2 by mammalian target of rapamycin.. J. Biol. Chem. 277: 31423 — 31429.  PubMed DOI:10.1074/jbc.M204080200
  • Desai B.N., Myers B.R., Schreiber S.L. (2002). FKBP12-rapamycin-associated protein associates with mitochondria and senses osmotic stress via mitochondrial dysfunction.. Proc. Natl. Acad. Sci. U.S.A. 99: 4319 — 4324.  PubMed DOI:10.1073/pnas.261702698
  • Inoki K., Zhu T., Guan K.L. (2003). TSC2 mediates cellular energy response to control cell growth and survival.. Cell 115: 577 — 590.  PubMed DOI:10.1016/S0092-8674(03)00929-2

Примітки[ред. | ред. код]

  1. а б Laplante M, Sabatini DM (2012). mTOR signaling in growth control and disease. Cell 149: 274—93. PMID 22500797. doi:10.1016/j.cell.2012.03.017. 
  2. HUGO Gene Nomenclature Commitee, HGNC:3942 (англ.). Процитовано 26 квітня 2018. 
  3. UniProt, P42345 (англ.). Процитовано 26 квітня 2018. 
  4. Alberts et al, 2007, с. 935

Джерела[ред. | ред. код]