PIAS2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PIAS2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PIAS2, ARIP3, DIP, MIZ, MIZ1, PIASX, PIASX-ALPHA, PIASX-BETA, SIZ2, ZMIZ4, Protein inhibitor of activated STAT2, protein inhibitor of activated STAT 2
Зовнішні ІД OMIM: 603567 MGI: 1096566 HomoloGene: 20979 GeneCards: PIAS2
Шаблон експресії
PBB GE PIAS2 37433 at fs.png

PBB GE PIAS2 214593 at fs.png

PBB GE PIAS2 214442 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001164167
NM_001164168
NM_001164169
NM_001164170
NM_008602
RefSeq (білок)
NP_001157639
NP_001157640
NP_001157641
NP_001157642
NP_032628
Локус (UCSC) Хр. 18: 46.8 – 46.92 Mb Хр. 18: 77.07 – 77.15 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PIAS2 (англ. Protein inhibitor of activated STAT 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 621 амінокислот, а молекулярна маса — 68 240[4].

Послідовність амінокислот
1020304050
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCS
PAVQIKIRELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAG
IHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDVQLKN
LPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPG
GRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKN
GIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGK
MRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILD
GLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQPCTKIESSSVL
SKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRKCIFMSETQSSP
TKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLPG
LDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSS
RSETGVITSSGSNIPDIISLD

Кодований геном білок за функціями належить до лігаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, убіквітинування білків, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Minty A., Dumont X., Kaghad M., Caput D. (2000). Covalent modification of p73alpha by SUMO-1. Two-hybrid screening with p73 identifies novel SUMO-1-interacting proteins and a SUMO-1 interaction motif.. J. Biol. Chem. 275: 36316 — 36323.  PubMed DOI:10.1074/jbc.M004293200
  • Miyauchi Y., Yogosawa S., Honda R., Nishida T., Yasuda H. (2002). Sumoylation of Mdm2 by protein inhibitor of activated STAT (PIAS) and RanBP2 enzymes.. J. Biol. Chem. 277: 50131 — 50136.  PubMed DOI:10.1074/jbc.M208319200
  • Schmidt D., Mueller S. (2002). Members of the PIAS family act as SUMO ligases for c-Jun and p53 and repress p53 activity.. Proc. Natl. Acad. Sci. U.S.A. 99: 2872 — 2877.  PubMed DOI:10.1073/pnas.052559499
  • Van Dyck F., Delvaux E.L.D., Van de Ven W.J.M., Chavez M.V. (2004). Repression of the transactivating capacity of the oncoprotein PLAG1 by SUMOylation.. J. Biol. Chem. 279: 36121 — 36131.  PubMed DOI:10.1074/jbc.M401753200
  • Yang S.-H., Sharrocks A.D. (2005). PIASx acts as an Elk-1 coactivator by facilitating derepression.. EMBO J. 24: 2161 — 2171.  PubMed DOI:10.1038/sj.emboj.7600690

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:17311 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O75928 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]