RIPK1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RIPK1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RIPK1, RIP, RIP1, RIP-1, receptor interacting serine/threonine kinase 1, IMD57, AIEFL
Зовнішні ІД OMIM: 603453 MGI: 108212 HomoloGene: 2820 GeneCards: RIPK1
Реагує на сполуку
Viroporin 3a [SARS-CoV-2][1]
Шаблон експресії
PBB GE RIPK1 209941 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_009068
NM_001359997
RefSeq (білок)
NP_033094
NP_001346926
Локус (UCSC) Хр. 6: 3.06 – 3.12 Mb Хр. 13: 34.19 – 34.22 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RIPK1 (англ. Receptor interacting serine/threonine kinase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 671 амінокислот, а молекулярна маса — 75 931[5].

Послідовність амінокислот
1020304050
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKG
PNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNL
MHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDF
HIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLND
VNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVD
DITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLG
MGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPR
QNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVH
QPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSL
HNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIG
GTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLA
QALHQCSRIDLLSSLIYVSQN

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

Література[ред. | ред. код]

  • Hsu H., Huang J., Shu H.-B., Baichwal V.R., Goeddel D.V. (1996). TNF-dependent recruitment of the protein kinase RIP to the TNF receptor-1 signaling complex.. Immunity 4: 387 — 396.  PubMed DOI:10.1016/S1074-7613(00)80252-6
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Stanger B.Z., Leder P., Lee T.-H., Kim E., Seed B. (1995). RIP: a novel protein containing a death domain that interacts with Fas/APO-1 (CD95) in yeast and causes cell death.. Cell 81: 513 — 523.  PubMed DOI:10.1016/0092-8674(95)90072-1
  • Lin Y., Devin A., Rodriguez Y., Liu Z.-G. (1999). Cleavage of the death domain kinase RIP by caspase-8 prompts TNF-induced apoptosis.. Genes Dev. 13: 2514 — 2526.  PubMed DOI:10.1101/gad.13.19.2514
  • Sanz L., Sanchez P., Lallena M.-J., Diaz-Meco M.T., Moscat J. (1999). The interaction of p62 with RIP links the atypical PKCs to NF-kappaB activation.. EMBO J. 18: 3044 — 3053.  PubMed DOI:10.1093/emboj/18.11.3044
  • Chen D., Li X., Zhai Z., Shu H.-B. (2002). A novel zinc finger protein interacts with receptor-interacting protein (RIP) and inhibits tumor necrosis factor (TNF)- and IL1-induced NF-kappa B activation.. J. Biol. Chem. 277: 15985 — 15991.  PubMed DOI:10.1074/jbc.M108675200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]