SPARC (ген)

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SPARC
Protein SPARC PDB 1bmo.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SPARC, BM-40, ON, OI17, secreted protein acidic and cysteine rich, ONT
Зовнішні ІД OMIM: 182120 MGI: 98373 HomoloGene: 31132 GeneCards: SPARC
Пов'язані генетичні захворювання
osteogenesis imperfecta type 17[1]
Шаблон експресії
PBB GE SPARC 200665 s at fs.png

PBB GE SPARC 212667 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003118
NM_001309443
NM_001309444
NM_009242
NM_001290817
RefSeq (білок)
NP_001296372
NP_001296373
NP_003109
NP_001277746
NP_033268
Локус (UCSC) Хр. 5: 151.66 – 151.69 Mb Хр. 11: 55.39 – 55.42 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SPARC (англ. Secreted protein acidic and cysteine rich) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 303 амінокислот, а молекулярна маса — 34 632[5].

Послідовність амінокислот
1020304050
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQV
EVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTS
CPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCK
YIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIH
ENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHT
ELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD
LVI

Задіяний у такому біологічному процесі як поліморфізм. Білок має сайт для зв'язування з іоном міді, іонами металів, іоном кальцію. Локалізований у позаклітинному матриксі, базальній мембрані. Також секретований назовні.

Література[ред. | ред. код]

  • Lankat-Buttgereit B., Mann K., Deutzmann R., Timpl R., Krieg T. (1988). Cloning and complete amino acid sequences of human and murine basement membrane protein BM-40 (SPARC, osteonectin).. FEBS Lett. 236: 352 — 356.  PubMed DOI:10.1016/0014-5793(88)80054-1
  • Swaroop A., Hogan B.L.M., Francke U. (1988). Molecular analysis of the cDNA for human SPARC/osteonectin/BM-40: sequence, expression, and localization of the gene to chromosome 5q31-q33.. Genomics 2: 37 — 47.  PubMed DOI:10.1016/0888-7543(88)90107-3
  • Villarreal X.C., Mann K.G., Long G.L. (1989). Structure of human osteonectin based upon analysis of cDNA and genomic sequences.. Biochemistry 28: 6483 — 6491.  PubMed DOI:10.1021/bi00441a049
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hunzelmann N., Hafner M., Anders S., Krieg T., Nischt R. (1998). BM-40 (osteonectin, SPARC) is expressed both in the epidermal and in the dermal compartment of adult human skin.. J. Invest. Dermatol. 110: 122 — 126.  PubMed DOI:10.1046/j.1523-1747.1998.00094.x
  • Hohenester E., Maurer P., Timpl R. (1997). Crystal structure of a pair of follistatin-like and EF-hand calcium-binding domains in BM-40.. EMBO J. 16: 3778 — 3786.  PubMed DOI:10.1093/emboj/16.13.3778

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]