SRA1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SRA1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SRA1, SRA, SRAP, STRAA1, pp7684, steroid receptor RNA activator 1
Зовнішні ІД OMIM: 603819 MGI: 1344414 HomoloGene: 11906 GeneCards: SRA1
Шаблон експресії
PBB GE SRA1 gnf1h06172 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001035235
NM_001253764
NM_001164406
NM_025291
RefSeq (білок)
NP_001030312
NP_001240693
NP_001157878
NP_079567
Локус (UCSC) Хр. 5: 140.54 – 140.56 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SRA1 (англ. Steroid receptor RNA activator 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 236 амінокислот, а молекулярна маса — 25 673[4].

Послідовність амінокислот
1020304050
MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLT
KRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEP
TSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAG
GKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKR
LIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS

Кодований геном білок за функціями належить до рибонуклеопротеїнів, рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, транскрипція, регуляція транскрипції, поліморфізм. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Deblois G., Giguere V. (2003). Ligand-independent coactivation of ERalpha AF-1 by steroid receptor RNA activator (SRA) via MAPK activation.. J. Steroid Biochem. Mol. Biol. 85: 123 — 131.  PubMed DOI:10.1016/S0960-0760(03)00225-5
  • Coleman K.M., Lam V., Jaber B.M., Lanz R.B., Smith C.L. (2004). SRA coactivation of estrogen receptor-alpha is phosphorylation-independent, and enhances 4-hydroxytamoxifen agonist activity.. Biochem. Biophys. Res. Commun. 323: 332 — 338.  PubMed DOI:10.1016/j.bbrc.2004.08.090

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11281 (англ.). Процитовано 5 вересня 2017. 
  4. UniProt, Q9HD15 (англ.). Процитовано 5 вересня 2017. 

Див. також[ред. | ред. код]