WDR13

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
WDR13
Ідентифікатори
Символи WDR13, MG21, WD repeat domain 13
Зовнішні ІД OMIM: 300512 MGI: 1914661 HomoloGene: 9899 GeneCards: WDR13
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001166426
NM_017883
NM_001347217
NM_001347219
NM_001290783
NM_026137
NM_028542
RefSeq (білок)
NP_001159898
NP_001334146
NP_001334148
NP_060353
NP_001277712
NP_080413
NP_082818
Локус (UCSC) Хр. X: 48.59 – 48.61 Mb Хр. X: 8.12 – 8.13 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

WDR13 (англ. WD repeat domain 13) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі X-хромосоми.[3] Довжина поліпептидного ланцюга білка становить 485 амінокислот, а молекулярна маса — 53 696[4].

Послідовність амінокислот
1020304050
MAAVWQQVLAVDARYNAYRTPTFPQFRTQYIRRRSQLLRENAKAGHPPAL
RRQYLRLRGQLLGQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDP
RALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAG
DTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLC
QLVPAPPTVLRVLRGHTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGR
CIREIPDPDSAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGS
SKLTGRVLALSFDAPGRLLWAGDDHGSVFSFLFDMATGKLTKAKRLVVHE
GSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFP
IEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVERAAKAAVNKLQ
GHSAPVLDVSFNCDESLLASSDASGMVIVWRREQK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг, метилювання. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:14352 (англ.). Процитовано 22 вересня 2017. 
  4. UniProt, Q9H1Z4 (англ.). Процитовано 22 вересня 2017. 

Див. також[ред. | ред. код]