Білок промієлоцитарного лейкозу

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Білок промієлоцитарного лейкозу
Protein PML PDB 1bor.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PML, MYL, PP8675, RNF71, TRIM19, Promyelocytic leukemia protein, promyelocytic leukemia, Probable transcription factor PML
Зовнішні ІД OMIM: 102578 MGI: 104662 HomoloGene: 13245 GeneCards: PML
Пов'язані генетичні захворювання
Короткозорість, mammary Paget's disease[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_008884
NM_178087
NM_001311088
RefSeq (білок)
NP_001298017
NP_032910
NP_835188
Локус (UCSC) Хр. 15: 73.99 – 74.05 Mb Хр. 9: 58.22 – 58.25 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Білок промієлоцитарного лейкозу (ПМЛ) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 882 амінокислот, а молекулярна маса — 97 551[5].

Послідовність амінокислот
1020304050
MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEE
EFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGAD
TPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAK
CFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLT
SIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQ
DSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG
FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSK
KASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAH
PVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEAR
LARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAG
EAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL
ADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYS
KAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEF
QEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAM
RDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLAL
HNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYF
EGLLEGPALARAEGVSTPLAGRGLAERASQQS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, імунітет, вроджений імунітет, взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, біологічні ритми, противірусний захист, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі, мембрані, ендоплазматичному ретикулумі, ендосомах.

Література[ред. | ред. код]

  • Goddard A.D., Borrow J., Freemont P.S., Solomon E. (1991). Characterization of a zinc finger gene disrupted by the t(15;17) in acute promyelocytic leukemia.. Science 254: 1371 — 1374.  PubMed DOI:10.1126/science.1720570
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Jensen K., Shiels C., Freemont P.S. (2001). PML protein isoforms and the RBCC/TRIM motif.. Oncogene 20: 7223 — 7233.  PubMed DOI:10.1038/sj.onc.1204765
  • Yang S., Kuo C., Bisi J.E., Kim M.K. (2002). PML-dependent apoptosis after DNA damage is regulated by the checkpoint kinase hCds1/Chk2.. Nat. Cell Biol. 4: 865 — 870.  PubMed DOI:10.1038/ncb869
  • Xu Z.-X., Timanova-Atanasova A., Zhao R.-X., Chang K.-S. (2003). PML colocalizes with and stabilizes the DNA damage response protein TopBP1.. Mol. Cell. Biol. 23: 4247 — 4256.  PubMed DOI:10.1128/MCB.23.12.4247-4256.2003
  • Daniels M.J., Marson A., Venkitaraman A.R. (2004). PML bodies control the nuclear dynamics and function of the CHFR mitotic checkpoint protein.. Nat. Struct. Mol. Biol. 11: 1114 — 1121.  PubMed DOI:10.1038/nsmb837

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]