CEP97

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CEP97
Ідентифікатори
Символи CEP97, 2810403B08Rik, LRRIQ2, centrosomal protein 97
Зовнішні ІД OMIM: 615864 MGI: 1921451 HomoloGene: 11579 GeneCards: CEP97
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001303401
NM_024548
NM_001159364
NM_001159365
NM_001159366
NM_028815
RefSeq (білок)
NP_001290330
NP_078824
NP_001152836
NP_001152837
NP_001152838
NP_083091
Локус (UCSC) Хр. 3: 101.72 – 101.77 Mb Хр. 16: 55.9 – 55.93 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CEP97 (англ. Centrosomal protein 97) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 865 амінокислот, а молекулярна маса — 96 981[4].

Послідовність амінокислот
1020304050
MAVARVDAALPPGEGSVVNWSGQGLQKLGPNLPCEADIHTLILDKNQIIK
LENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKE
LVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKT
LLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQL
SIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLY
SQGKGRAYRPGQHIQLVQYLATVCPLTSTLGLQTAEDAKLEKILSKQRFH
QRQLMNQSQNEELSPLVPVETRASLIPEHSSPVQDCQISQESEPVIQVNS
WVGINSNDDQLFAVKNNFPASVHTTRYSRNDLHLEDIQTDEDKLNCSLLS
SESTFMPVASGLSPLSPTVELRLQGINLGLEDDGVADESVKGLESQVLDK
EEEQPLWAANENSVQMMRSEINTEVNEKAGLLPCPEPTIISAILKDDNHS
LTFFPESTEQKQSDIKKPENTQPENKETISQATSEKLPMILTQRSVALGQ
DKVALQKLNDAATKLQACWRGFYARNYNPQAKDVRYEIRLRRMQEHIVCL
TDEIRRLRKERDEERIKKFVQEEAFRFLWNQVRSLQVWQQTVDQRLSSWH
TDVPPISSTLVPSKHPLFTQSQESSCDQNADWFIASDVAPQEKSLPEFPD
SGFHSSLTEQVHSLQHSLDFEKSSTEGSESSIMGNSIDTVRYGKESDLGD
VSEEHGEWNKESSNNEQDNSLLEQYLTSVQQLEDADERTNFDTETRDSKL
HIACFPVQLDTLSDGASVDESHGISPPLQGEISQTQENSKLNAEVQGQQP
ECDSTFQLLHVGVTV

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як біогенез та деградація війок, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою кальмодуліну. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Spektor A., Tsang W.Y., Khoo D., Dynlacht B.D. (2007). Cep97 and CP110 suppress a cilia assembly program.. Cell 130: 678 — 690.  PubMed DOI:10.1016/j.cell.2007.06.027
  • Kobayashi T., Tsang W.Y., Li J., Lane W., Dynlacht B.D. (2011). Centriolar kinesin Kif24 interacts with CP110 to remodel microtubules and regulate ciliogenesis.. Cell 145: 914 — 925.  PubMed DOI:10.1016/j.cell.2011.04.028
  • Al-Hakim A.K., Bashkurov M., Gingras A.C., Durocher D., Pelletier L. (2012). Interaction proteomics identify NEURL4 and the HECT E3 ligase HERC2 as novel modulators of centrosome architecture.. Mol. Cell. Proteomics 11: M111.014233.01 — M111.014233.14.  PubMed DOI:10.1074/mcp.M111.014233
  • Kobayashi T., Kim S., Lin Y.C., Inoue T., Dynlacht B.D. (2014). The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.. J. Cell Biol. 204: 215 — 229.  PubMed DOI:10.1083/jcb.201304153

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:26244 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q8IW35 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]